Human APOC1/Apo-CI/apo-CIB ORF/cDNA clone-Lentivirus plasmid (NM_001645)

Cat. No.: pGMLP000390
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human APOC1/Apo-CI/apo-CIB Lentiviral expression plasmid for APOC1 lentivirus packaging, APOC1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to APOC1/Apo-CI products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000390
Gene Name APOC1
Accession Number NM_001645
Gene ID 341
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 252 bp
Gene Alias Apo-CI,apo-CIB,ApoC-I,apoC-IB
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGCTCTTCCTGTCGCTCCCGGTCCTGGTGGTGGTTCTGTCGATCGTCTTGGAAGGCCCAGCCCCAGCCCAGGGGACCCCAGACGTCTCCAGTGCCTTGGATAAGCTGAAGGAGTTTGGAAACACACTGGAGGACAAGGCTCGGGAACTCATCAGCCGCATCAAACAGAGTGAACTTTCTGCCAAGATGCGGGAGTGGTTTTCAGAGACATTTCAGAAAGTGAAGGAGAAACTCAAGATTGACTCATGA
ORF Protein Sequence MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0672-Ab Anti-APOC1/ Apo-CI/ ApoC-I functional antibody
    Target Antigen GM-Tg-g-SE0672-Ag APOC1 protein
    ORF Viral Vector pGMLP000390 Human APOC1 Lentivirus plasmid
    ORF Viral Vector vGMLP000390 Human APOC1 Lentivirus particle


    Target information

    Target ID GM-SE0672
    Target Name APOC1
    Gene ID 341, 11812, 106994799, 25292, 101086520, 476437, 102147873
    Gene Symbol and Synonyms ALPCI,Apo-CI,apo-CIB,ApoC-I,apoC-IB,APOC1,APOC1B,LRRG04
    Uniprot Accession P02654
    Uniprot Entry Name APOC1_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease gastric cancer
    Gene Ensembl ENSG00000130208
    Target Classification Not Available

    This gene encodes a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. The encoded protein plays a central role in high density lipoprotein (HDL) and very low density lipoprotein (VLDL) metabolism. This protein has also been shown to inhibit cholesteryl ester transfer protein in plasma. A pseudogene of this gene is located 4 kb downstream in the same orientation, on the same chromosome. This gene is mapped to chromosome 19, where it resides within a apolipoprotein gene cluster. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Sep 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.