Human S100A3/S100E ORF/cDNA clone-Lentivirus plasmid (NM_002960)
Cat. No.: pGMLP000395
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human S100A3/S100E Lentiviral expression plasmid for S100A3 lentivirus packaging, S100A3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
S100A3/S100E products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP000395 |
Gene Name | S100A3 |
Accession Number | NM_002960 |
Gene ID | 6274 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 306 bp |
Gene Alias | S100E |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCCAGGCCTCTGGAGCAGGCGGTAGCTGCCATCGTGTGCACCTTCCAGGAATACGCAGGGCGCTGTGGGGACAAATACAAGCTCTGCCAGGCGGAGCTCAAGGAGCTGCTGCAGAAGGAGCTGGCCACCTGGACCCCGACTGAGTTTCGGGAATGTGACTACAACAAATTCATGAGTGTTCTGGACACCAACAAGGACTGCGAGGTGGACTTTGTGGAGTATGTGCGCTCACTTGCCTGCCTCTGTCTCTACTGCCACGAGTACTTCAAGGACTGCCCCTCAGAGCCCCCCTGCTCCCAGTAG |
ORF Protein Sequence | MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T93537-Ab | Anti-S10A3/ S100A3/ S100E monoclonal antibody |
Target Antigen | GM-Tg-g-T93537-Ag | S100A3 VLP (virus-like particle) |
ORF Viral Vector | pGMLP000395 | Human S100A3 Lentivirus plasmid |
ORF Viral Vector | vGMLP000395 | Human S100A3 Lentivirus particle |
Target information
Target ID | GM-T93537 |
Target Name | S100A3 |
Gene ID | 6274, 20197, 100426715, 114216, 101087447, 490460, 786230, 100061923 |
Gene Symbol and Synonyms | S100A3,S100E |
Uniprot Accession | P33764 |
Uniprot Entry Name | S10A3_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | Cancer |
Gene Ensembl | ENSG00000188015 |
Target Classification | Tumor-associated antigen (TAA) |
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.