Human FMOD/FM/SLRR2E ORF/cDNA clone-Lentivirus plasmid (NM_002023)

Cat. No.: pGMLP000601
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FMOD/FM/SLRR2E Lentiviral expression plasmid for FMOD lentivirus packaging, FMOD lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to FMOD/FM products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $616.68
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000601
Gene Name FMOD
Accession Number NM_002023
Gene ID 2331
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1131 bp
Gene Alias FM,SLRR2E
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGTGGACCTCCCTCCTGCTGCTGGCAGGGCTCTTCTCCCTCTCCCAGGCCCAGTATGAAGATGACCCTCATTGGTGGTTCCACTACCTCCGCAGCCAGCAGTCCACCTACTACGATCCCTATGACCCTTACCCGTATGAGACCTACGAGCCTTACCCCTATGGGGTGGATGAAGGGCCAGCCTACACCTACGGCTCTCCATCCCCTCCAGATCCCCGCGACTGCCCCCAGGAGTGCGACTGCCCACCCAACTTCCCCACGGCCATGTACTGTGACAATCGCAACCTCAAGTACCTGCCCTTCGTTCCCTCCCGCATGAAGTATGTGTACTTCCAGAACAACCAGATCACCTCCATCCAGGAAGGCGTCTTTGACAATGCCACAGGGCTGCTCTGGATTGCTCTCCACGGCAACCAGATCACCAGTGATAAGGTGGGCAGGAAGGTCTTCTCCAAGCTGAGGCACCTGGAGAGGCTGTACCTGGACCACAACAACCTGACCCGGATGCCCGGTCCCCTGCCTCGATCCCTGAGAGAGCTCCATCTCGACCACAACCAGATCTCACGGGTCCCCAACAATGCTCTGGAGGGGCTGGAGAACCTCACGGCCTTGTACCTCCAACACAATGAGATCCAGGAAGTGGGCAGTTCCATGAGGGGCCTCCGGTCACTGATCTTGCTGGACCTGAGTTATAACCACCTTCGGAAGGTGCCTGATGGGCTGCCCTCAGCTCTTGAGCAGCTGTACATGGAGCACAACAATGTCTACACCGTCCCCGATAGCTACTTCCGGGGGGCGCCCAAGCTGCTGTATGTGCGGCTGTCCCACAACAGTCTAACCAACAATGGCCTGGCCTCCAACACCTTCAATTCCAGCAGCCTCCTTGAGCTAGACCTCTCCTACAACCAGCTGCAGAAGATCCCCCCAGTCAACACCAACCTGGAGAACCTCTACCTCCAAGGCAATAGGATCAATGAGTTCTCCATCAGCAGCTTCTGCACCGTGGTGGACGTCGTGAACTTCTCCAAGCTGCAGGTGCTGCGCCTGGACGGGAACGAGATCAAGCGCAGCGCCATGCCTGCCGACGCGCCCCTCTGCCTGCGCCTTGCCAGCCTCATCGAGATCTGA
ORF Protein Sequence MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMPADAPLCLRLASLIEI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0927-Ab Anti-FMOD/ FM/ SLRR2E functional antibody
    Target Antigen GM-Tg-g-SE0927-Ag FMOD protein
    ORF Viral Vector pGMLP000601 Human FMOD Lentivirus plasmid
    ORF Viral Vector pGMPC001715 Human FMOD Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000601 Human FMOD Lentivirus particle


    Target information

    Target ID GM-SE0927
    Target Name FMOD
    Gene ID 2331, 14264, 703048, 64507, 101101027, 488560, 281168, 100009678
    Gene Symbol and Synonyms FM,FMOD,SLRR2E
    Uniprot Accession Q06828
    Uniprot Entry Name FMOD_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000122176
    Target Classification Not Available

    Fibromodulin belongs to the family of small interstitial proteoglycans. The encoded protein possesses a central region containing leucine-rich repeats with 4 keratan sulfate chains, flanked by terminal domains containing disulphide bonds. Owing to the interaction with type I and type II collagen fibrils and in vitro inhibition of fibrillogenesis, the encoded protein may play a role in the assembly of extracellular matrix. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix. Sequence variations in this gene may be associated with the pathogenesis of high myopia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.