Human FMOD/FM/SLRR2E ORF/cDNA clone-Lentivirus particle (NM_002023)
Cat. No.: vGMLP000601
Pre-made Human FMOD/FM/SLRR2E Lentiviral expression plasmid for FMOD lentivirus packaging, FMOD lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
FMOD/FM products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP000601 | Human FMOD Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP000601 |
Gene Name | FMOD |
Accession Number | NM_002023 |
Gene ID | 2331 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 1131 bp |
Gene Alias | FM,SLRR2E |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCAGTGGACCTCCCTCCTGCTGCTGGCAGGGCTCTTCTCCCTCTCCCAGGCCCAGTATGAAGATGACCCTCATTGGTGGTTCCACTACCTCCGCAGCCAGCAGTCCACCTACTACGATCCCTATGACCCTTACCCGTATGAGACCTACGAGCCTTACCCCTATGGGGTGGATGAAGGGCCAGCCTACACCTACGGCTCTCCATCCCCTCCAGATCCCCGCGACTGCCCCCAGGAGTGCGACTGCCCACCCAACTTCCCCACGGCCATGTACTGTGACAATCGCAACCTCAAGTACCTGCCCTTCGTTCCCTCCCGCATGAAGTATGTGTACTTCCAGAACAACCAGATCACCTCCATCCAGGAAGGCGTCTTTGACAATGCCACAGGGCTGCTCTGGATTGCTCTCCACGGCAACCAGATCACCAGTGATAAGGTGGGCAGGAAGGTCTTCTCCAAGCTGAGGCACCTGGAGAGGCTGTACCTGGACCACAACAACCTGACCCGGATGCCCGGTCCCCTGCCTCGATCCCTGAGAGAGCTCCATCTCGACCACAACCAGATCTCACGGGTCCCCAACAATGCTCTGGAGGGGCTGGAGAACCTCACGGCCTTGTACCTCCAACACAATGAGATCCAGGAAGTGGGCAGTTCCATGAGGGGCCTCCGGTCACTGATCTTGCTGGACCTGAGTTATAACCACCTTCGGAAGGTGCCTGATGGGCTGCCCTCAGCTCTTGAGCAGCTGTACATGGAGCACAACAATGTCTACACCGTCCCCGATAGCTACTTCCGGGGGGCGCCCAAGCTGCTGTATGTGCGGCTGTCCCACAACAGTCTAACCAACAATGGCCTGGCCTCCAACACCTTCAATTCCAGCAGCCTCCTTGAGCTAGACCTCTCCTACAACCAGCTGCAGAAGATCCCCCCAGTCAACACCAACCTGGAGAACCTCTACCTCCAAGGCAATAGGATCAATGAGTTCTCCATCAGCAGCTTCTGCACCGTGGTGGACGTCGTGAACTTCTCCAAGCTGCAGGTGCTGCGCCTGGACGGGAACGAGATCAAGCGCAGCGCCATGCCTGCCGACGCGCCCCTCTGCCTGCGCCTTGCCAGCCTCATCGAGATCTGA |
ORF Protein Sequence | MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMPADAPLCLRLASLIEI |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0927-Ab | Anti-FMOD/ FM/ SLRR2E functional antibody |
Target Antigen | GM-Tg-g-SE0927-Ag | FMOD protein |
ORF Viral Vector | pGMLP000601 | Human FMOD Lentivirus plasmid |
ORF Viral Vector | pGMPC001715 | Human FMOD Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP000601 | Human FMOD Lentivirus particle |
Target information
Target ID | GM-SE0927 |
Target Name | FMOD |
Gene ID | 2331, 14264, 703048, 64507, 101101027, 488560, 281168, 100009678 |
Gene Symbol and Synonyms | FM,FMOD,SLRR2E |
Uniprot Accession | Q06828 |
Uniprot Entry Name | FMOD_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000122176 |
Target Classification | Not Available |
Fibromodulin belongs to the family of small interstitial proteoglycans. The encoded protein possesses a central region containing leucine-rich repeats with 4 keratan sulfate chains, flanked by terminal domains containing disulphide bonds. Owing to the interaction with type I and type II collagen fibrils and in vitro inhibition of fibrillogenesis, the encoded protein may play a role in the assembly of extracellular matrix. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix. Sequence variations in this gene may be associated with the pathogenesis of high myopia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.