Human CH25H/C25H ORF/cDNA clone-Lentivirus plasmid (NM_003956)

Cat. No.: pGMLP000722
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CH25H/C25H Lentiviral expression plasmid for CH25H lentivirus packaging, CH25H lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CH25H/C25H products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $504.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000722
Gene Name CH25H
Accession Number NM_003956
Gene ID 9023
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 819 bp
Gene Alias C25H
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGCTGCCACAACTGCTCCGACCCCCAGGTCCTTTGCAGCTCCGGGCAGCTGTTCCTGCAGCCCCTCTGGGACCACCTGAGGAGCTGGGAGGCCCTCCTACAGTCGCCCTTCTTCCCGGTCATCTTCTCCATCACCACATACGTGGGCTTTTGCCTGCCCTTCGTGGTCCTGGATATCCTGTGCTCCTGGGTGCCCGCCCTGCGGCGCTACAAGATCCACCCTGACTTCTCGCCATCCGCGCAGCAGCTGCTACCTTGCCTGGGGCAGACCCTCTACCAGCATGTGATGTTTGTGTTCCCCGTGACGCTGCTGCATTGGGCCCGCAGCCCGGCCCTCCTGCCCCACGAAGCTCCCGAGCTGCTCCTGCTGCTGCACCACATCCTGTTCTGCCTGCTACTCTTCGACATGGAGTTCTTCGTGTGGCACCTGCTGCACCACAAGGTGCCCTGGCTGTACCGCACCTTCCACAAGGTGCACCACCAGAACTCGTCCTCGTTCGCGCTGGCAACGCAGTATATGAGCGTCTGGGAACTGTTTTCTTTGGGCTTCTTCGACATGATGAACGTCACACTGCTCGGGTGCCACCCGCTCACCACCCTGACCTTCCACGTGGTCAACATCTGGCTTTCCGTGGAGGACCACTCCGGCTACAACTTCCCTTGGTCCACTCACAGACTGGTGCCCTTCGGGTGGTACGGGGGTGTGGTGCACCACGACCTGCATCACTCTCACTTTAACTGCAACTTCGCTCCGTACTTTACACACTGGGACAAAATACTGGGAACGCTGCGGACTGCATCTGTCCCAGCGCGGTGA
ORF Protein Sequence MSCHNCSDPQVLCSSGQLFLQPLWDHLRSWEALLQSPFFPVIFSITTYVGFCLPFVVLDILCSWVPALRRYKIHPDFSPSAQQLLPCLGQTLYQHVMFVFPVTLLHWARSPALLPHEAPELLLLLHHILFCLLLFDMEFFVWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVPAR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0541-Ab Anti-CH25H monoclonal antibody
    Target Antigen GM-Tg-g-IP0541-Ag CH25H protein
    ORF Viral Vector pGMLP000722 Human CH25H Lentivirus plasmid
    ORF Viral Vector pGMPC000204 Human ch25h Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000722 Human CH25H Lentivirus particle


    Target information

    Target ID GM-IP0541
    Target Name CH25H
    Gene ID 9023, 12642, 694532, 309527, 101098893, 100856263, 506132, 100062138
    Gene Symbol and Synonyms C25H,CH25H,m25OH
    Uniprot Accession O95992
    Uniprot Entry Name CH25H_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000138135
    Target Classification Not Available

    This is an intronless gene that is involved in cholesterol and lipid metabolism. The encoded protein is a membrane protein and contains clusters of histidine residues essential for catalytic activity. Unlike most other sterol hydroxylases, this enzyme is a member of a small family of enzymes that utilize diiron cofactors to catalyze the hydroxylation of hydrophobic substrates. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.