Human CH25H/C25H ORF/cDNA clone-Lentivirus particle (NM_003956)
Cat. No.: vGMLP000722
Pre-made Human CH25H/C25H Lentiviral expression plasmid for CH25H lentivirus packaging, CH25H lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CH25H/C25H products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP000722 | Human CH25H Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP000722 |
| Gene Name | CH25H |
| Accession Number | NM_003956 |
| Gene ID | 9023 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 819 bp |
| Gene Alias | C25H |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAGCTGCCACAACTGCTCCGACCCCCAGGTCCTTTGCAGCTCCGGGCAGCTGTTCCTGCAGCCCCTCTGGGACCACCTGAGGAGCTGGGAGGCCCTCCTACAGTCGCCCTTCTTCCCGGTCATCTTCTCCATCACCACATACGTGGGCTTTTGCCTGCCCTTCGTGGTCCTGGATATCCTGTGCTCCTGGGTGCCCGCCCTGCGGCGCTACAAGATCCACCCTGACTTCTCGCCATCCGCGCAGCAGCTGCTACCTTGCCTGGGGCAGACCCTCTACCAGCATGTGATGTTTGTGTTCCCCGTGACGCTGCTGCATTGGGCCCGCAGCCCGGCCCTCCTGCCCCACGAAGCTCCCGAGCTGCTCCTGCTGCTGCACCACATCCTGTTCTGCCTGCTACTCTTCGACATGGAGTTCTTCGTGTGGCACCTGCTGCACCACAAGGTGCCCTGGCTGTACCGCACCTTCCACAAGGTGCACCACCAGAACTCGTCCTCGTTCGCGCTGGCAACGCAGTATATGAGCGTCTGGGAACTGTTTTCTTTGGGCTTCTTCGACATGATGAACGTCACACTGCTCGGGTGCCACCCGCTCACCACCCTGACCTTCCACGTGGTCAACATCTGGCTTTCCGTGGAGGACCACTCCGGCTACAACTTCCCTTGGTCCACTCACAGACTGGTGCCCTTCGGGTGGTACGGGGGTGTGGTGCACCACGACCTGCATCACTCTCACTTTAACTGCAACTTCGCTCCGTACTTTACACACTGGGACAAAATACTGGGAACGCTGCGGACTGCATCTGTCCCAGCGCGGTGA |
| ORF Protein Sequence | MSCHNCSDPQVLCSSGQLFLQPLWDHLRSWEALLQSPFFPVIFSITTYVGFCLPFVVLDILCSWVPALRRYKIHPDFSPSAQQLLPCLGQTLYQHVMFVFPVTLLHWARSPALLPHEAPELLLLLHHILFCLLLFDMEFFVWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVPAR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP0541-Ab | Anti-CH25H monoclonal antibody |
| Target Antigen | GM-Tg-g-IP0541-Ag | CH25H protein |
| ORF Viral Vector | pGMLP000722 | Human CH25H Lentivirus plasmid |
| ORF Viral Vector | pGMPC000204 | Human ch25h Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP000722 | Human CH25H Lentivirus particle |
Target information
| Target ID | GM-IP0541 |
| Target Name | CH25H |
| Gene ID | 9023, 12642, 694532, 309527, 101098893, 100856263, 506132, 100062138 |
| Gene Symbol and Synonyms | C25H,CH25H,m25OH |
| Uniprot Accession | O95992 |
| Uniprot Entry Name | CH25H_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000138135 |
| Target Classification | Not Available |
This is an intronless gene that is involved in cholesterol and lipid metabolism. The encoded protein is a membrane protein and contains clusters of histidine residues essential for catalytic activity. Unlike most other sterol hydroxylases, this enzyme is a member of a small family of enzymes that utilize diiron cofactors to catalyze the hydroxylation of hydrophobic substrates. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


