Human XPA/XP1/XPAC ORF/cDNA clone-Lentivirus plasmid (NM_000380)

Cat. No.: pGMLP000752
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human XPA/XP1/XPAC Lentiviral expression plasmid for XPA lentivirus packaging, XPA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to XPA/XP1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $505.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000752
Gene Name XPA
Accession Number NM_000380
Gene ID 7507
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 822 bp
Gene Alias XP1,XPAC
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCGGCCGACGGGGCTTTGCCGGAGGCGGCGGCTTTAGAGCAACCCGCGGAGCTGCCTGCCTCGGTGCGGGCGAGTATCGAGCGGAAGCGGCAGCGGGCACTGATGCTGCGCCAGGCCCGGCTGGCTGCCCGGCCCTACTCGGCGACGGCGGCTGCGGCTACTGGAGGCATGGCTAATGTAAAAGCAGCCCCAAAGATAATTGACACAGGAGGAGGCTTCATTTTAGAAGAGGAAGAAGAAGAAGAACAGAAAATTGGAAAAGTTGTTCATCAACCAGGACCTGTTATGGAATTTGATTATGTAATATGCGAAGAATGTGGGAAAGAATTTATGGATTCTTATCTTATGAACCACTTTGATTTGCCAACTTGTGATAACTGCAGAGATGCTGATGATAAACACAAGCTTATAACCAAAACAGAGGCAAAACAAGAATATCTTCTGAAAGACTGTGATTTAGAAAAAAGAGAGCCACCTCTTAAATTTATTGTGAAGAAGAATCCACATCATTCACAATGGGGTGATATGAAACTCTACTTAAAGTTACAGATTGTGAAGAGGTCTCTTGAAGTTTGGGGTAGTCAAGAAGCATTAGAAGAAGCAAAGGAAGTCCGACAGGAAAACCGAGAAAAAATGAAACAGAAGAAATTTGATAAAAAAGTAAAAGAATTGCGGCGAGCAGTAAGAAGCAGCGTGTGGAAAAGGGAGACGATTGTTCATCAACATGAGTATGGACCAGAAGAAAACCTAGAAGATGACATGTACCGTAAGACTTGTACTATGTGTGGCCATGAACTGACATATGAAAAAATGTGA
ORF Protein Sequence MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T48040-Ab Anti-XPA monoclonal antibody
    Target Antigen GM-Tg-g-T48040-Ag XPA protein
    ORF Viral Vector pGMLP000752 Human XPA Lentivirus plasmid
    ORF Viral Vector vGMLP000752 Human XPA Lentivirus particle


    Target information

    Target ID GM-T48040
    Target Name XPA
    Gene ID 7507, 22590, 715705, 298074, 101091820, 481623, 537958, 100064497
    Gene Symbol and Synonyms XP1,XPA,XPAC
    Uniprot Accession P23025
    Uniprot Entry Name XPA_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000136936
    Target Classification Tumor-associated antigen (TAA)

    This gene encodes a zinc finger protein plays a central role in nucleotide excision repair (NER), a specialized type of DNA repair. NER is responsible for repair of UV radiation-induced photoproducts and DNA adducts induced by chemical carcinogens and chemotherapeutic drugs. The encoded protein interacts with DNA and several NER proteins, acting as a scaffold to assemble the NER incision complex at sites of DNA damage. Mutations in this gene cause Xeroderma pigmentosum complementation group A (XP-A), an autosomal recessive skin disorder featuring hypersensitivity to sunlight and increased risk for skin cancer. [provided by RefSeq, Aug 2017]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.