Human XPA/XP1/XPAC ORF/cDNA clone-Lentivirus particle (NM_000380)
Cat. No.: vGMLP000752
Pre-made Human XPA/XP1/XPAC Lentiviral expression plasmid for XPA lentivirus packaging, XPA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
XPA/XP1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP000752 | Human XPA Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP000752 |
Gene Name | XPA |
Accession Number | NM_000380 |
Gene ID | 7507 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 822 bp |
Gene Alias | XP1,XPAC |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCGGCGGCCGACGGGGCTTTGCCGGAGGCGGCGGCTTTAGAGCAACCCGCGGAGCTGCCTGCCTCGGTGCGGGCGAGTATCGAGCGGAAGCGGCAGCGGGCACTGATGCTGCGCCAGGCCCGGCTGGCTGCCCGGCCCTACTCGGCGACGGCGGCTGCGGCTACTGGAGGCATGGCTAATGTAAAAGCAGCCCCAAAGATAATTGACACAGGAGGAGGCTTCATTTTAGAAGAGGAAGAAGAAGAAGAACAGAAAATTGGAAAAGTTGTTCATCAACCAGGACCTGTTATGGAATTTGATTATGTAATATGCGAAGAATGTGGGAAAGAATTTATGGATTCTTATCTTATGAACCACTTTGATTTGCCAACTTGTGATAACTGCAGAGATGCTGATGATAAACACAAGCTTATAACCAAAACAGAGGCAAAACAAGAATATCTTCTGAAAGACTGTGATTTAGAAAAAAGAGAGCCACCTCTTAAATTTATTGTGAAGAAGAATCCACATCATTCACAATGGGGTGATATGAAACTCTACTTAAAGTTACAGATTGTGAAGAGGTCTCTTGAAGTTTGGGGTAGTCAAGAAGCATTAGAAGAAGCAAAGGAAGTCCGACAGGAAAACCGAGAAAAAATGAAACAGAAGAAATTTGATAAAAAAGTAAAAGAATTGCGGCGAGCAGTAAGAAGCAGCGTGTGGAAAAGGGAGACGATTGTTCATCAACATGAGTATGGACCAGAAGAAAACCTAGAAGATGACATGTACCGTAAGACTTGTACTATGTGTGGCCATGAACTGACATATGAAAAAATGTGA |
ORF Protein Sequence | MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T48040-Ab | Anti-XPA monoclonal antibody |
Target Antigen | GM-Tg-g-T48040-Ag | XPA protein |
ORF Viral Vector | pGMLP000752 | Human XPA Lentivirus plasmid |
ORF Viral Vector | vGMLP000752 | Human XPA Lentivirus particle |
Target information
Target ID | GM-T48040 |
Target Name | XPA |
Gene ID | 7507, 22590, 715705, 298074, 101091820, 481623, 537958, 100064497 |
Gene Symbol and Synonyms | XP1,XPA,XPAC |
Uniprot Accession | P23025 |
Uniprot Entry Name | XPA_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Cancer |
Gene Ensembl | ENSG00000136936 |
Target Classification | Tumor-associated antigen (TAA) |
This gene encodes a zinc finger protein plays a central role in nucleotide excision repair (NER), a specialized type of DNA repair. NER is responsible for repair of UV radiation-induced photoproducts and DNA adducts induced by chemical carcinogens and chemotherapeutic drugs. The encoded protein interacts with DNA and several NER proteins, acting as a scaffold to assemble the NER incision complex at sites of DNA damage. Mutations in this gene cause Xeroderma pigmentosum complementation group A (XP-A), an autosomal recessive skin disorder featuring hypersensitivity to sunlight and increased risk for skin cancer. [provided by RefSeq, Aug 2017]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.