Human VAMP7/SYBL1/TI-VAMP ORF/cDNA clone-Lentivirus plasmid (NM_005638)

Cat. No.: pGMLP000809
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human VAMP7/SYBL1/TI-VAMP Lentiviral expression plasmid for VAMP7 lentivirus packaging, VAMP7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to VAMP7/SYBL1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $465.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000809
Gene Name VAMP7
Accession Number NM_005638
Gene ID 6845
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 663 bp
Gene Alias SYBL1,TI-VAMP,TIVAMP,VAMP-7
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGATTCTTTTTGCTGTTGTTGCCAGGGGGACCACTATCCTTGCCAAACATGCTTGGTGTGGAGGAAACTTCCTGGAGGTGACAGAGCAGATTCTGGCTAAGATACCTTCTGAAAATAACAAACTAACGTACTCACATGGCAATTATTTGTTTCATTACATCTGCCAAGACAGGATTGTATATCTTTGTATCACTGATGATGATTTTGAACGTTCCCGAGCCTTTAATTTTCTGAATGAGATAAAGAAGAGGTTCCAGACTACTTACGGTTCAAGAGCACAGACAGCACTTCCATATGCCATGAATAGCGAGTTCTCAAGTGTCTTAGCTGCACAGCTGAAGCATCACTCTGAGAATAAGGGCCTAGACAAAGTGATGGAGACTCAAGCCCAAGTGGATGAACTGAAAGGAATCATGGTCAGAAACATAGATCTGGTAGCTCAGCGAGGAGAAAGATTGGAATTATTGATTGACAAAACAGAAAATCTTGTGGATTCTTCTGTCACCTTCAAAACTACCAGCAGAAATCTTGCTCGAGCCATGTGTATGAAGAACCTCAAGCTCACTATTATCATCATCATCGTATCAATTGTGTTCATCTATATCATTGTTTCACCTCTCTGTGGTGGATTTACATGGCCAAGCTGTGTGAAGAAATAG
ORF Protein Sequence MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNLKLTIIIIIVSIVFIYIIVSPLCGGFTWPSCVKK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1914-Ab Anti-VAMP7/ SYBL1/ TI-VAMP monoclonal antibody
    Target Antigen GM-Tg-g-MP1914-Ag VAMP7 VLP (virus-like particle)
    ORF Viral Vector pGMLP000809 Human VAMP7 Lentivirus plasmid
    ORF Viral Vector vGMLP000809 Human VAMP7 Lentivirus particle


    Target information

    Target ID GM-MP1914
    Target Name VAMP7
    Gene ID 6845, 20955, 704160, 85491, 101095160, 612663, 613984, 100062131
    Gene Symbol and Synonyms SYBL1,TI-VAMP,TIVAMP,VAMP-7,VAMP7
    Uniprot Accession P51809
    Uniprot Entry Name VAMP7_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000124333
    Target Classification Not Available

    This gene encodes a transmembrane protein that is a member of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) family. The encoded protein localizes to late endosomes and lysosomes and is involved in the fusion of transport vesicles to their target membranes. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Jun 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.