Human GAST/GAS ORF/cDNA clone-Lentivirus plasmid (NM_000805)

Cat. No.: pGMLP000817
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GAST/GAS Lentiviral expression plasmid for GAST lentivirus packaging, GAST lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to GAST/GAS products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000817
Gene Name GAST
Accession Number NM_000805
Gene ID 2520
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 306 bp
Gene Alias GAS
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGCGACTGTGTGTGTATGTGCTGATCTTTGCACTGGCTCTGGCCGCCTTCTCTGAAGCTTCTTGGAAGCCCCGCTCCCAGCAGCCAGATGCACCCTTAGGTACAGGGGCCAACAGGGACCTGGAGCTACCCTGGCTGGAGCAGCAGGGCCCAGCCTCTCATCATCGAAGGCAGCTGGGACCCCAGGGTCCCCCACACCTCGTGGCAGACCCGTCCAAGAAGCAGGGACCATGGCTGGAGGAAGAAGAAGAAGCCTATGGATGGATGGACTTCGGCCGCCGCAGTGCTGAGGATGAGAACTAA
ORF Protein Sequence MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T16128-Ab Anti-GAST/ GAS functional antibody
    Target Antigen GM-Tg-g-T16128-Ag GAST protein
    ORF Viral Vector pGMLP000817 Human GAST Lentivirus plasmid
    ORF Viral Vector pGMAP000283 Human GAS Adenovirus plasmid
    ORF Viral Vector vGMLP000817 Human GAST Lentivirus particle
    ORF Viral Vector vGMAP000283 Human GAS Adenovirus particle


    Target information

    Target ID GM-T16128
    Target Name GAST
    Gene ID 2520, 14459, 707564, 25320, 101092065, 100685087, 280800, 100034214
    Gene Symbol and Synonyms GAS,GAST,PPG34
    Uniprot Accession P01350
    Uniprot Entry Name GAST_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Diagnostics Biomarker
    Disease Cancer
    Gene Ensembl ENSG00000184502
    Target Classification Tumor-associated antigen (TAA)

    Gastrin is a hormone whose main function is to stimulate secretion of hydrochloric acid by the gastric mucosa, which results in gastrin formation inhibition. This hormone also acts as a mitogenic factor for gastrointestinal epithelial cells. Gastrin has two biologically active peptide forms, G34 and G17. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.