Human GAST/GAS ORF/cDNA clone-Lentivirus particle (NM_000805)
Cat. No.: vGMLP000817
Pre-made Human GAST/GAS Lentiviral expression plasmid for GAST lentivirus packaging, GAST lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
GAST/GAS products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP000817 | Human GAST Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP000817 |
| Gene Name | GAST |
| Accession Number | NM_000805 |
| Gene ID | 2520 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 306 bp |
| Gene Alias | GAS |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCAGCGACTGTGTGTGTATGTGCTGATCTTTGCACTGGCTCTGGCCGCCTTCTCTGAAGCTTCTTGGAAGCCCCGCTCCCAGCAGCCAGATGCACCCTTAGGTACAGGGGCCAACAGGGACCTGGAGCTACCCTGGCTGGAGCAGCAGGGCCCAGCCTCTCATCATCGAAGGCAGCTGGGACCCCAGGGTCCCCCACACCTCGTGGCAGACCCGTCCAAGAAGCAGGGACCATGGCTGGAGGAAGAAGAAGAAGCCTATGGATGGATGGACTTCGGCCGCCGCAGTGCTGAGGATGAGAACTAA |
| ORF Protein Sequence | MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T16128-Ab | Anti-GAST/ GAS functional antibody |
| Target Antigen | GM-Tg-g-T16128-Ag | GAST protein |
| ORF Viral Vector | pGMLP000817 | Human GAST Lentivirus plasmid |
| ORF Viral Vector | pGMAP000283 | Human GAS Adenovirus plasmid |
| ORF Viral Vector | vGMLP000817 | Human GAST Lentivirus particle |
| ORF Viral Vector | vGMAP000283 | Human GAS Adenovirus particle |
Target information
| Target ID | GM-T16128 |
| Target Name | GAST |
| Gene ID | 2520, 14459, 707564, 25320, 101092065, 100685087, 280800, 100034214 |
| Gene Symbol and Synonyms | GAS,GAST,PPG34 |
| Uniprot Accession | P01350 |
| Uniprot Entry Name | GAST_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Diagnostics Biomarker |
| Disease | Cancer |
| Gene Ensembl | ENSG00000184502 |
| Target Classification | Tumor-associated antigen (TAA) |
Gastrin is a hormone whose main function is to stimulate secretion of hydrochloric acid by the gastric mucosa, which results in gastrin formation inhibition. This hormone also acts as a mitogenic factor for gastrointestinal epithelial cells. Gastrin has two biologically active peptide forms, G34 and G17. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


