Human VAMP4/VAMP-4/VAMP24 ORF/cDNA clone-Lentivirus plasmid (NM_003762)

Cat. No.: pGMLP000853
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human VAMP4/VAMP-4/VAMP24 Lentiviral expression plasmid for VAMP4 lentivirus packaging, VAMP4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to VAMP4/VAMP-4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000853
Gene Name VAMP4
Accession Number NM_003762
Gene ID 8674
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 426 bp
Gene Alias VAMP-4,VAMP24
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCTCCCAAGTTTAAGCGCCACCTCAATGATGATGATGTCACAGGTTCTGTGAAAAGTGAAAGGAGAAATCTTTTGGAAGATGATTCAGATGAAGAAGAGGACTTTTTTCTAAGGGGACCATCTGGACCAAGATTTGGACCTAGAAATGATAAAATTAAGCATGTTCAGAATCAAGTGGATGAAGTTATTGATGTCATGCAAGAAAATATTACAAAGGTAATTGAGAGAGGGGAGAGACTAGATGAACTACAGGACAAATCAGAAAGCTTATCGGATAATGCAACAGCTTTTAGCAACAGATCCAAACAACTTCGAAGGCAAATGTGGTGGCGTGGATGCAAAATAAAAGCCATCATGGCTTTGGTTGCTGCTATCCTTTTGCTAGTGATTATCATTCTTATAGTCATGAAATACCGTACTTGA
ORF Protein Sequence MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1912-Ab Anti-VAMP4/ VAMP-4/ VAMP24 monoclonal antibody
    Target Antigen GM-Tg-g-MP1912-Ag VAMP4 VLP (virus-like particle)
    ORF Viral Vector pGMLP000853 Human VAMP4 Lentivirus plasmid
    ORF Viral Vector vGMLP000853 Human VAMP4 Lentivirus particle


    Target information

    Target ID GM-MP1912
    Target Name VAMP4
    Gene ID 8674, 53330, 704733, 364033, 101087894, 106559029, 616923, 100052201
    Gene Symbol and Synonyms D1Ertd147e,VAMP-4,VAMP24,VAMP4
    Uniprot Accession O75379
    Uniprot Entry Name VAMP4_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Prostate Cancer
    Gene Ensembl ENSG00000117533
    Target Classification Not Available

    Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. This protein may play a role in trans-Golgi network-to-endosome transport. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.