Human FXYD2/ATP1G1/HOMG2 ORF/cDNA clone-Lentivirus plasmid (NM_001680)
Cat. No.: pGMLP000938
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human FXYD2/ATP1G1/HOMG2 Lentiviral expression plasmid for FXYD2 lentivirus packaging, FXYD2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
FXYD2/ATP1G1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP000938 |
Gene Name | FXYD2 |
Accession Number | NM_001680 |
Gene ID | 486 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 201 bp |
Gene Alias | ATP1G1,HOMG2 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGACTGGGTTGTCGATGGACGGTGGCGGCAGCCCCAAGGGGGACGTGGACCCGTTCTACTATGACTATGAGACCGTTCGCAATGGGGGCCTGATCTTCGCTGGACTGGCCTTCATCGTGGGGCTCCTCATCCTCCTCAGCAGAAGATTCCGCTGTGGGGGCAATAAGAAGCGCAGGCAAATCAATGAAGATGAGCCGTAA |
ORF Protein Sequence | MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP0455-Ab | Anti-ATNG/ FXYD2/ ATP1G1 monoclonal antibody |
Target Antigen | GM-Tg-g-MP0455-Ag | FXYD2 VLP (virus-like particle) |
ORF Viral Vector | pGMLP000938 | Human FXYD2 Lentivirus plasmid |
ORF Viral Vector | vGMLP000938 | Human FXYD2 Lentivirus particle |
Target information
Target ID | GM-MP0455 |
Target Name | FXYD2 |
Gene ID | 486, 11936, 29639, 101087093, 608594, 281773, 100629801 |
Gene Symbol and Synonyms | ATP1C,ATP1G1,FXYD2,GNAKATP,HOMG2 |
Uniprot Accession | P54710 |
Uniprot Entry Name | ATNG_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000137731 |
Target Classification | Not Available |
This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.[provided by RefSeq, Feb 2011]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.