Human FXYD2/ATP1G1/HOMG2 ORF/cDNA clone-Lentivirus plasmid (NM_001680)

Cat. No.: pGMLP000938
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FXYD2/ATP1G1/HOMG2 Lentiviral expression plasmid for FXYD2 lentivirus packaging, FXYD2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to FXYD2/ATP1G1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000938
Gene Name FXYD2
Accession Number NM_001680
Gene ID 486
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 201 bp
Gene Alias ATP1G1,HOMG2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACTGGGTTGTCGATGGACGGTGGCGGCAGCCCCAAGGGGGACGTGGACCCGTTCTACTATGACTATGAGACCGTTCGCAATGGGGGCCTGATCTTCGCTGGACTGGCCTTCATCGTGGGGCTCCTCATCCTCCTCAGCAGAAGATTCCGCTGTGGGGGCAATAAGAAGCGCAGGCAAATCAATGAAGATGAGCCGTAA
ORF Protein Sequence MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0455-Ab Anti-ATNG/ FXYD2/ ATP1G1 monoclonal antibody
    Target Antigen GM-Tg-g-MP0455-Ag FXYD2 VLP (virus-like particle)
    ORF Viral Vector pGMLP000938 Human FXYD2 Lentivirus plasmid
    ORF Viral Vector vGMLP000938 Human FXYD2 Lentivirus particle


    Target information

    Target ID GM-MP0455
    Target Name FXYD2
    Gene ID 486, 11936, 29639, 101087093, 608594, 281773, 100629801
    Gene Symbol and Synonyms ATP1C,ATP1G1,FXYD2,GNAKATP,HOMG2
    Uniprot Accession P54710
    Uniprot Entry Name ATNG_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000137731
    Target Classification Not Available

    This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.[provided by RefSeq, Feb 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.