Human ULBP1/N2DL-1/NKG2DL1 ORF/cDNA clone-Lentivirus plasmid (NM_025218)

Cat. No.: pGMLP001010
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ULBP1/N2DL-1/NKG2DL1 Lentiviral expression plasmid for ULBP1 lentivirus packaging, ULBP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to ULBP1/N2DL-1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $483.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001010
Gene Name ULBP1
Accession Number NM_025218
Gene ID 80329
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 735 bp
Gene Alias N2DL-1,NKG2DL1,RAET1I
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGCGGCCGCCAGCCCCGCGTTCCTTCTGTGCCTCCCGCTTCTGCACCTGCTGTCTGGCTGGTCCCGGGCAGGATGGGTCGACACACACTGTCTTTGCTATGACTTCATCATCACTCCTAAGTCCAGACCTGAACCACAGTGGTGTGAAGTTCAAGGCCTGGTGGATGAAAGGCCTTTTCTTCACTATGACTGTGTTAACCACAAGGCCAAAGCCTTTGCTTCTCTGGGGAAGAAAGTCAATGTCACAAAAACCTGGGAAGAACAAACTGAAACACTAAGAGACGTGGTGGATTTCCTTAAAGGGCAACTGCTTGACATTCAAGTGGAGAATTTAATACCCATTGAGCCCCTCACCCTGCAGGCCAGGATGTCTTGTGAGCATGAAGCCCATGGACACGGCAGAGGATCTTGGCAGTTCCTCTTCAATGGACAGAAGTTCCTCCTCTTTGACTCAAACAACAGAAAGTGGACAGCACTTCATCCTGGAGCCAAGAAGATGACAGAGAAGTGGGAGAAGAACAGGGATGTGACCATGTTCTTCCAGAAGATTTCACTGGGGGATTGTAAGATGTGGCTTGAAGAATTTTTGATGTACTGGGAACAAATGCTGGATCCAACAAAACCACCCTCTCTGGCCCCAGGCACAACCCAACCCAAGGCCATGGCCACCACCCTCAGTCCCTGGAGCCTTCTCATCATCTTCCTCTGCTTCATTCTAGCTGGCAGATGA
ORF Protein Sequence MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGTTQPKAMATTLSPWSLLIIFLCFILAGR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1898-Ab Anti-ULBP1/ N2DL-1/ NKG2DL1 monoclonal antibody
    Target Antigen GM-Tg-g-MP1898-Ag ULBP1 VLP (virus-like particle)
    ORF Viral Vector pGMLP001010 Human ULBP1 Lentivirus plasmid
    ORF Viral Vector pGMLP001856 Human ULBP1 Lentivirus plasmid
    ORF Viral Vector vGMLP001010 Human ULBP1 Lentivirus particle
    ORF Viral Vector vGMLP001856 Human ULBP1 Lentivirus particle


    Target information

    Target ID GM-MP1898
    Target Name ULBP1
    Gene ID 80329, 77777
    Gene Symbol and Synonyms A430108B07Rik,MULT1,N2DL-1,NKG2DL1,RAET1I,ULBP1
    Uniprot Accession Q9BZM6
    Uniprot Entry Name ULBP1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000111981
    Target Classification Not Available

    The protein encoded by this gene is a ligand of natural killer group 2, member D (NKG2D), an immune system-activating receptor on NK cells and T-cells. Binding of the encoded ligand to NKG2D leads to activation of several signal transduction pathways, including those of JAK2, STAT5, ERK and PI3K kinase/Akt. Also, in cytomegalovirus-infected cells, this ligand binds the UL16 glycoprotein and is prevented from activating the immune system. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.