Human STX2/EPIM/EPM ORF/cDNA clone-Lentivirus plasmid (NM_194356)

Cat. No.: pGMLP001218
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human STX2/EPIM/EPM Lentiviral expression plasmid for STX2 lentivirus packaging, STX2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to STX2/EPIM products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $516.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001218
Gene Name STX2
Accession Number NM_194356
Gene ID 2054
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 867 bp
Gene Alias EPIM,EPM,STX2A,STX2B,STX2C
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGGGACCGGCTGCCAGACCTGACGGCGTGTAGGAAGAATGATGATGGAGACACAGTTGTTGTGGTTGAGAAAGATCATTTCATGGATGATTTCTTCCATCAGGTGGAGGAGATTAGAAACAGTATTGATAAAATAACTCAATATGTTGAAGAAGTAAAGAAAAACCACAGCATCATTCTTTCTGCACCAAACCCGGAAGGAAAAATAAAAGAAGAGCTTGAAGATCTGAACAAAGAAATCAAGAAAACTGCGAATAAAATTCGAGCCAAGTTAAAGGCTATTGAACAAAGTTTTGATCAGGATGAGAGTGGGAACCGGACTTCAGTGGATCTTCGGATACGAAGAACCCAGCATTCGGTGCTGTCTCGGAAGTTTGTGGAAGCCATGGCGGAGTACAATGAGGCACAGACTCTGTTTCGGGAGCGGAGCAAAGGCCGCATCCAGCGCCAGCTGGAGATAACTGGGAGAACCACCACAGACGACGAGCTAGAAGAGATGCTGGAGAGCGGGAAGCCATCCATCTTCACTTCCGACATTATATCAGATTCACAAATTACTAGACAAGCTCTCAATGAAATCGAGTCACGTCACAAGGACATCATGAAGCTGGAGACCAGCATCCGAGAGTTGCATGAGATGTTCATGGACATGGCTATGTTTGTGGAGACTCAGGGTGAAATGATCAACAACATAGAAAGAAATGTTATGAATGCCACAGACTATGTAGAACACGCTAAAGAAGAAACAAAAAAAGCTATCAAATATCAGAGCAAGGCAAGAAGGAAAAAGTGGATAATTATTGCTGTGTCAGTGGTTCTGGTTGCCATAATCGCTCTAATTATTGGCTTGTCAGTTGGCAAATGA
ORF Protein Sequence MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKKWIIIAVSVVLVAIIALIIGLSVGK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1726-Ab Anti-STX2/ EPIM/ EPMA monoclonal antibody
    Target Antigen GM-Tg-g-MP1726-Ag STX2 VLP (virus-like particle)
    ORF Viral Vector pGMLP001218 Human STX2 Lentivirus plasmid
    ORF Viral Vector vGMLP001218 Human STX2 Lentivirus particle


    Target information

    Target ID GM-MP1726
    Target Name STX2
    Gene ID 2054, 13852, 718628, 25130, 101080921, 477439, 519148, 100062798
    Gene Symbol and Synonyms EPIM,EPM,G1-536-1,repro34,STX2,STX2A,STX2B,STX2C,Syn-2
    Uniprot Accession P32856
    Uniprot Entry Name STX2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000111450
    Target Classification Not Available

    The product of this gene belongs to the syntaxin/epimorphin family of proteins. The syntaxins are a large protein family implicated in the targeting and fusion of intracellular transport vesicles. The product of this gene regulates epithelial-mesenchymal interactions and epithelial cell morphogenesis and activation. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.