Human UBE2J1/CGI-76/HSPC153 ORF/cDNA clone-Lentivirus plasmid (NM_016021.2)
Cat. No.: pGMLP001254
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human UBE2J1/CGI-76/HSPC153 Lentiviral expression plasmid for UBE2J1 lentivirus packaging, UBE2J1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
UBE2J1/CGI-76 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP001254 |
Gene Name | UBE2J1 |
Accession Number | NM_016021.2 |
Gene ID | 51465 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 957 bp |
Gene Alias | CGI-76,HSPC153,HSPC205,HSU93243,NCUBE-1,NCUBE1,UBC6,UBC6E,Ubc6p |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGAGACCCGCTACAACCTGAAGAGTCCGGCTGTTAAACGTTTAATGAAAGAAGCGGCAGAATTGAAAGATCCAACAGATCATTACCATGCGCAGCCTTTAGAGGATAACCTTTTTGAATGGCACTTCACGGTTAGAGGGCCCCCAGACTCCGATTTTGATGGAGGAGTTTATCACGGGCGGATAGTACTGCCACCAGAGTATCCCATGAAACCACCAAGCATTATTCTCCTAACGGCTAATGGTCGATTTGAAGTGGGCAAGAAAATCTGTTTGAGCATCTCAGGCCATCATCCTGAAACTTGGCAGCCTTCGTGGAGTATAAGGACAGCATTATTAGCCATCATTGGGTTTATGCCAACAAAAGGAGAGGGAGCCATAGGTTCTCTAGATTACACTCCTGAGGAAAGAAGAGCACTTGCCAAAAAATCACAAGATTTCTGTTGTGAAGGATGTGGCTCTGCCATGAAGGATGTCCTGTTGCCTTTAAAATCTGGAAGCGATTCAAGCCAAGCTGACCAAGAAGCCAAAGAACTGGCTAGGCAAATAAGCTTTAAGGCAGAAGTCAATTCATCTGGAAAGACTATCTCTGAGTCAGACTTAAACCACTCTTTTTCACTAACTGATTTACAAGATGATATACCTACAACATTCCAGGGTGCTACGGCCAGTACATCGTACGGACTCCAGAATTCCTCAGCAGCATCCTTTCATCAACCTACCCAACCTGTAGCTAAGAATACCTCCATGAGCCCTCGACAGCGCCGGGCCCAGCAGCAGAGTCAGAGAAGGTTGTCTACTTCACCAGATGTAATCCAGGGCCACCAGCCAAGAGACAACCACACTGATCATGGTGGGTCAGCTGTACTGATTGTCATCCTGACTTTGGCATTGGCAGCTCTTATATTCCGACGAATATATCTGGCAAACGAATACATATTTGACTTTGAGTTATAA |
ORF Protein Sequence | METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERRALAKKSQDFCCEGCGSAMKDVLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESDLNHSFSLTDLQDDIPTTFQGATASTSYGLQNSSAASFHQPTQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDNHTDHGGSAVLIVILTLALAALIFRRIYLANEYIFDFEL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP2220-Ab | Anti-UBE2J1 monoclonal antibody |
Target Antigen | GM-Tg-g-IP2220-Ag | UBE2J1 protein |
ORF Viral Vector | pGMLP001254 | Human UBE2J1 Lentivirus plasmid |
ORF Viral Vector | vGMLP001254 | Human UBE2J1 Lentivirus particle |
Target information
Target ID | GM-IP2220 |
Target Name | UBE2J1 |
Gene ID | 51465, 56228, 701100, 297961, 101093860, 474993, 539754, 100071009 |
Gene Symbol and Synonyms | 0710008M05Rik,1110030I22Rik,CGI-76,HSPC153,HSPC205,HSU93243,Ncube,NCUBE-1,NCUBE1,UBC6,UBC6E,Ubc6p,UBE2J1 |
Uniprot Accession | Q9Y385 |
Uniprot Entry Name | UB2J1_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Prostate Cancer |
Gene Ensembl | ENSG00000198833 |
Target Classification | Not Available |
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum (ER) and may contribute to quality control ER-associated degradation by the ubiquitin-proteasome system. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.