Human UBE2J1/CGI-76/HSPC153 ORF/cDNA clone-Lentivirus particle (NM_016021.2)

Cat. No.: vGMLP001254

Pre-made Human UBE2J1/CGI-76/HSPC153 Lentiviral expression plasmid for UBE2J1 lentivirus packaging, UBE2J1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to UBE2J1/CGI-76 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001254 Human UBE2J1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001254
Gene Name UBE2J1
Accession Number NM_016021.2
Gene ID 51465
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 957 bp
Gene Alias CGI-76,HSPC153,HSPC205,HSU93243,NCUBE-1,NCUBE1,UBC6,UBC6E,Ubc6p
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGACCCGCTACAACCTGAAGAGTCCGGCTGTTAAACGTTTAATGAAAGAAGCGGCAGAATTGAAAGATCCAACAGATCATTACCATGCGCAGCCTTTAGAGGATAACCTTTTTGAATGGCACTTCACGGTTAGAGGGCCCCCAGACTCCGATTTTGATGGAGGAGTTTATCACGGGCGGATAGTACTGCCACCAGAGTATCCCATGAAACCACCAAGCATTATTCTCCTAACGGCTAATGGTCGATTTGAAGTGGGCAAGAAAATCTGTTTGAGCATCTCAGGCCATCATCCTGAAACTTGGCAGCCTTCGTGGAGTATAAGGACAGCATTATTAGCCATCATTGGGTTTATGCCAACAAAAGGAGAGGGAGCCATAGGTTCTCTAGATTACACTCCTGAGGAAAGAAGAGCACTTGCCAAAAAATCACAAGATTTCTGTTGTGAAGGATGTGGCTCTGCCATGAAGGATGTCCTGTTGCCTTTAAAATCTGGAAGCGATTCAAGCCAAGCTGACCAAGAAGCCAAAGAACTGGCTAGGCAAATAAGCTTTAAGGCAGAAGTCAATTCATCTGGAAAGACTATCTCTGAGTCAGACTTAAACCACTCTTTTTCACTAACTGATTTACAAGATGATATACCTACAACATTCCAGGGTGCTACGGCCAGTACATCGTACGGACTCCAGAATTCCTCAGCAGCATCCTTTCATCAACCTACCCAACCTGTAGCTAAGAATACCTCCATGAGCCCTCGACAGCGCCGGGCCCAGCAGCAGAGTCAGAGAAGGTTGTCTACTTCACCAGATGTAATCCAGGGCCACCAGCCAAGAGACAACCACACTGATCATGGTGGGTCAGCTGTACTGATTGTCATCCTGACTTTGGCATTGGCAGCTCTTATATTCCGACGAATATATCTGGCAAACGAATACATATTTGACTTTGAGTTATAA
ORF Protein Sequence METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERRALAKKSQDFCCEGCGSAMKDVLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESDLNHSFSLTDLQDDIPTTFQGATASTSYGLQNSSAASFHQPTQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDNHTDHGGSAVLIVILTLALAALIFRRIYLANEYIFDFEL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2220-Ab Anti-UBE2J1 monoclonal antibody
    Target Antigen GM-Tg-g-IP2220-Ag UBE2J1 protein
    ORF Viral Vector pGMLP001254 Human UBE2J1 Lentivirus plasmid
    ORF Viral Vector vGMLP001254 Human UBE2J1 Lentivirus particle


    Target information

    Target ID GM-IP2220
    Target Name UBE2J1
    Gene ID 51465, 56228, 701100, 297961, 101093860, 474993, 539754, 100071009
    Gene Symbol and Synonyms 0710008M05Rik,1110030I22Rik,CGI-76,HSPC153,HSPC205,HSU93243,Ncube,NCUBE-1,NCUBE1,UBC6,UBC6E,Ubc6p,UBE2J1
    Uniprot Accession Q9Y385
    Uniprot Entry Name UB2J1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Prostate Cancer
    Gene Ensembl ENSG00000198833
    Target Classification Not Available

    The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum (ER) and may contribute to quality control ER-associated degradation by the ubiquitin-proteasome system. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.