Human GNB2 ORF/cDNA clone-Lentivirus plasmid (NM_005273.3)

Cat. No.: pGMLP001265
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GNB2/ Lentiviral expression plasmid for GNB2 lentivirus packaging, GNB2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to GNB2/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $586.44
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001265
Gene Name GNB2
Accession Number NM_005273.3
Gene ID 2783
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1023 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGTGAGCTGGAGCAACTGAGACAGGAGGCCGAGCAGCTCCGGAACCAGATCCGGGATGCCCGAAAAGCATGTGGGGACTCAACACTGACCCAGATCACAGCTGGGCTGGACCCAGTGGGGAGAATCCAGATGAGGACCCGGAGGACCCTCCGTGGGCACCTGGCAAAGATCTATGCCATGCACTGGGGGACCGACTCAAGGCTGCTGGTCAGCGCCTCCCAGGATGGGAAGCTCATCATCTGGGACAGCTACACCACCAACAAGGTCCACGCCATCCCGCTGCGCTCCTCCTGGGTAATGACCTGTGCCTACGCGCCCTCAGGGAACTTTGTGGCCTGTGGGGGGTTGGACAACATCTGCTCCATCTACAGCCTCAAGACCCGCGAGGGCAACGTCAGGGTCAGCCGGGAGCTGCCTGGCCACACTGGGTACCTGTCGTGTTGCCGCTTCCTGGATGACAACCAAATCATCACCAGCTCTGGGGATACCACCTGTGCCCTGTGGGACATTGAGACAGGCCAGCAGACAGTGGGTTTTGCTGGACACAGTGGGGATGTGATGTCCCTGTCCCTGGCCCCCGATGGCCGCACGTTTGTGTCAGGCGCCTGTGATGCCTCTATCAAGCTGTGGGACGTGCGGGATTCCATGTGCCGACAGACCTTCATCGGCCATGAATCCGACATCAATGCAGTGGCTTTCTTCCCCAACGGCTACGCCTTCACCACCGGCTCTGACGACGCCACGTGCCGCCTCTTCGACCTGCGGGCCGATCAGGAGCTCCTCATGTACTCCCATGACAACATCATCTGTGGCATCACCTCTGTTGCCTTCTCGCGCAGCGGACGGCTGCTGCTCGCTGGCTACGACGACTTCAACTGCAACATCTGGGATGCCATGAAGGGCGACCGTGCAGGAGTCCTCGCTGGCCACGACAACCGCGTGAGCTGCCTCGGGGTCACCGACGATGGCATGGCTGTGGCCACGGGCTCCTGGGACTCCTTCCTCAAGATCTGGAACTAA
ORF Protein Sequence MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2146-Ab Anti-GBB2/ GNB2 monoclonal antibody
    Target Antigen GM-Tg-g-MP2146-Ag GNB2 VLP (virus-like particle)
    ORF Viral Vector pGMLP001265 Human GNB2 Lentivirus plasmid
    ORF Viral Vector vGMLP001265 Human GNB2 Lentivirus particle


    Target information

    Target ID GM-MP2146
    Target Name GNB2
    Gene ID 2783, 14693, 719248, 81667, 101093317, 479733, 281202, 100067486
    Gene Symbol and Synonyms Gnb-2,GNB2,HG2C1,SSS4,SSS4; NEDHYDF
    Uniprot Accession P62879
    Uniprot Entry Name GBB2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000172354
    Target Classification Not Available

    Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. This gene contains a trinucleotide (CCG) repeat length polymorphism in its 5' UTR. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.