Human PCBP2/hnRNP-E2/HNRNPE2 ORF/cDNA clone-Lentivirus plasmid (NM_021127)

Cat. No.: pGMLP001413
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PCBP2/hnRNP-E2/HNRNPE2 Lentiviral expression plasmid for PCBP2 lentivirus packaging, PCBP2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to PCBP2/hnRNP-E2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $608.28
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001413
Gene Name PCBP2
Accession Number NM_021127
Gene ID 5094
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1101 bp
Gene Alias hnRNP-E2,HNRNPE2,HNRPE2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCTGGGAAGAAGGCGCGCAAGAACGCTCAACCGAGCCCCGCGCGGGCTCCAGCAGAGCTGGAAGTCGAGTGTGCTACTCAACTCAGGAGATTTGGAGACAAACTGAACTTCCGGCAGAAACTTCTGAATCTGATATCCAAACTCTTCTGCTCAGGAACCTGA
ORF Protein Sequence MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1328-Ab Anti-PCBP2 monoclonal antibody
    Target Antigen GM-Tg-g-IP1328-Ag PCBP2 protein
    ORF Viral Vector pGMLP001413 Human PCBP2 Lentivirus plasmid
    ORF Viral Vector vGMLP001413 Human PCBP2 Lentivirus particle


    Target information

    Target ID GM-IP1328
    Target Name PCBP2
    Gene ID 5094, 18521, 703175, 363005, 101086733, 477596, 540653, 100062163
    Gene Symbol and Synonyms alphaCP-2,hnRNP-E2,HNRNPE2,HNRPE2,Hnrpx,PCBP2
    Uniprot Accession Q15366
    Uniprot Entry Name PCBP2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000197111
    Target Classification Not Available

    The protein encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. This gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2018]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.