Human VASH1/KIAA1036 ORF/cDNA clone-Lentivirus plasmid (NM_014909)
Cat. No.: pGMLP001438
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human VASH1/KIAA1036 Lentiviral expression plasmid for VASH1 lentivirus packaging, VASH1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
VASH1/KIAA1036 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP001438 |
Gene Name | VASH1 |
Accession Number | NM_014909 |
Gene ID | 22846 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 1098 bp |
Gene Alias | KIAA1036 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCCAGGGGGGAAGAAGGTGGCTGGGGGTGGCAGCAGCGGTGCCACTCCAACGTCCGCTGCGGCCACCGCCCCCTCTGGGGTCAGGCGTTTGGAGACCAGCGAAGGAACCTCAGCCCAGAGAGATGAGGAGCCAGAAGAGGAAGGGGAAGAGGACCTGCGAGACGGAGGCGTCCCCTTCTTTGTCAACCGGGGTGGGCTACCTGTGGATGAGGCCACCTGGGAAAGGATGTGGAAACACGTGGCCAAGATCCACCCCGATGGAGAGAAGGTGGCGCAACGGATCCGTGGGGCCACAGACCTGCCCAAGATCCCCATACCGAGTGTGCCTACGTTCCAGCCGTCTACACCTGTCCCTGAGCGCCTGGAAGCTGTGCAGCGCTACATCAGAGAGCTGCAGTACAATCACACAGGGACACAGTTCTTTGAAATTAAGAAGAGCAGACCTCTGACAGGGCTGATGGACCTGGCCAAGGAAATGACCAAAGAGGCCCTGCCAATCAAATGCCTGGAAGCCGTGATCCTGGGAATTTACCTCACCAACAGCATGCCCACCCTGGAGCGCTTCCCCATCAGCTTCAAGACCTACTTCTCAGGGAACTACTTCCGCCACATCGTGCTGGGGGTGAACTTCGCGGGCCGCTACGGTGCGCTGGGCATGAGTCGGCGCGAGGACCTGATGTACAAGCCGCCCGCCTTCCGCACGCTCAGCGAGCTCGTGCTGGACTTCGAGGCCGCCTACGGCCGCTGCTGGCACGTGCTCAAGAAGGTGAAGCTGGGCCAGAGCGTGTCACACGACCCGCACAGCGTGGAGCAGATCGAGTGGAAGCACTCGGTGCTGGACGTGGAGCGCCTGGGCCGCGATGACTTCCGCAAGGAGCTGGAGCGCCACGCCCGCGACATGCGGCTCAAGATTGGCAAAGGGACGGGCCCTCCCTCTCCCACCAAGGACCGGAAGAAGGATGTTTCTTCCCCGCAGCGGGCCCAGTCCAGCCCCCACCGCAGGAACAGCCGCAGTGAAAGACGGCCCTCGGGTGACAAGAAGACTTCCGAGCCCAAAGCCATGCCAGACCTTAACGGGTACCAGATCCGGGTCTGA |
ORF Protein Sequence | MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGIYLTNSMPTLERFPISFKTYFSGNYFRHIVLGVNFAGRYGALGMSRREDLMYKPPAFRTLSELVLDFEAAYGRCWHVLKKVKLGQSVSHDPHSVEQIEWKHSVLDVERLGRDDFRKELERHARDMRLKIGKGTGPPSPTKDRKKDVSSPQRAQSSPHRRNSRSERRPSGDKKTSEPKAMPDLNGYQIRV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE1359-Ab | Anti-VASH1/ KIAA1036/ TTCP 1 functional antibody |
Target Antigen | GM-Tg-g-SE1359-Ag | VASH1 protein |
ORF Viral Vector | pGMLP001438 | Human VASH1 Lentivirus plasmid |
ORF Viral Vector | pGMLV001962 | Human VASH1 Lentivirus plasmid |
ORF Viral Vector | pGMAP000253 | Human VASH1 Adenovirus plasmid |
ORF Viral Vector | vGMLP001438 | Human VASH1 Lentivirus particle |
ORF Viral Vector | vGMLV001962 | Human VASH1 Lentivirus particle |
ORF Viral Vector | vGMAP000253 | Human VASH1 Adenovirus particle |
Target information
Target ID | GM-SE1359 |
Target Name | VASH1 |
Gene ID | 22846, 238328, 703906, 503052, 101100138, 490799, 615419, 100051887 |
Gene Symbol and Synonyms | D930046M13Rik,G630009D10Rik,KIAA1036,RGD1564082,TTCP 1,VASH1 |
Uniprot Accession | Q7L8A9 |
Uniprot Entry Name | VASH1_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000071246 |
Target Classification | Not Available |
Enables actin binding activity and metallocarboxypeptidase activity. Involved in negative regulation of angiogenesis; negative regulation of blood vessel endothelial cell migration; and proteolysis. Acts upstream of or within several processes, including negative regulation of endothelial cell migration; negative regulation of endothelial cell proliferation; and negative regulation of lymphangiogenesis. Located in apical part of cell; endoplasmic reticulum; and extracellular space. Implicated in liver cirrhosis and portal hypertension. Biomarker of liver cirrhosis. [provided by Alliance of Genome Resources, Apr 2022]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.