Human E2F2/E2F-2 ORF/cDNA clone-Lentivirus plasmid (NM_004091)
Cat. No.: pGMLP001489
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human E2F2/E2F-2 Lentiviral expression plasmid for E2F2 lentivirus packaging, E2F2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
E2F2/E2F-2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP001489 |
Gene Name | E2F2 |
Accession Number | NM_004091 |
Gene ID | 1870 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 1314 bp |
Gene Alias | E2F-2 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCTGCAAGGGCCCCGGGCCTTGGCTTCGGCCGCTGGGCAGACCCCGAAGGTGGTGCCCGCGATGAGCCCCACAGAGCTGTGGCCATCCGGCCTCAGCAGCCCCCAGCTCTGCCCAGCTACTGCTACCTACTACACACCGCTGTACCCGCAGACGGCGCCTCCCGCAGCGGCGCCAGGCACCTGCCTCGACGCCACTCCCCACGGACCCGAGGGCCAAGTTGTGCGATGCCTGCCGGCAGGCCGGCTGCCGGCCAAAAGGAAGCTGGATCTGGAGGGGATTGGGAGGCCCGTCGTCCCTGAGTTCCCAACCCCCAAGGGGAAGTGCATCAGAGTGGATGGCCTCCCCAGCCCCAAAACCCCCAAATCCCCCGGGGAGAAGACTCGGTATGACACTTCGCTGGGGCTGCTCACCAAGAAGTTCATTTACCTCCTGAGCGAGTCAGAGGATGGGGTCCTGGACCTGAACTGGGCCGCTGAGGTGCTGGACGTGCAGAAGCGGCGCATCTATGACATCACCAACGTGCTGGAAGGCATCCAGCTCATCCGCAAGAAGGCCAAGAACAACATCCAGTGGGTAGGCAGGGGAATGTTTGAAGACCCCACCAGACCTGGGAAGCAGCAACAGCTGGGGCAGGAGCTGAAGGAGCTGATGAACACGGAGCAGGCCTTGGACCAGCTCATCCAGAGCTGCTCTCTGAGCTTCAAGCACCTGACTGAGGACAAGGCCAACAAGAGGCTGGCCTATGTGACTTACCAGGATATCCGTGCTGTTGGCAACTTTAAGGAGCAGACAGTGATTGCCGTCAAGGCCCCTCCGCAGACGAGACTGGAAGTGCCCGACAGGACTGAGGACAACCTGCAGATATATCTCAAGAGCACCCAAGGGCCCATCGAAGTCTACCTGTGCCCAGAGGAGGTGCAGGAGCCGGACAGTCCTTCCGAGGAGCCTCTCCCCTCTACCTCCACCCTCTGCCCCAGCCCTGACTCTGCCCAGCCCAGCAGCAGCACCGACCCTAGCATCATGGAGCCCACAGCATCCTCAGTGCCAGCACCAGCGCCAACCCCCCAGCAGGCCCCACCGCCTCCATCCCTGGTCCCCTTGGAGGCTACTGACAGCCTGCTGGAGCTGCCGCACCCACTCCTGCAGCAGACTGAGGACCAGTTCCTGTCCCCGACCCTGGCGTGCAGCTCCCCTCTGATCAGCTTCTCCCCATCCTTGGACCAGGACGACTACCTGTGGGGCTTGGAGGCGGGTGAGGGCATCAGCGATCTCTTCGACTCCTACGACCTTGGGGACCTGTTGATTAATTGA |
ORF Protein Sequence | MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPGTCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALDQLIQSCSLSFKHLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEVYLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAPPPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLIN |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T16180-Ab | Anti-E2F2 monoclonal antibody |
Target Antigen | GM-Tg-g-T16180-Ag | E2F2 protein |
ORF Viral Vector | pGMLP001489 | Human E2F2 Lentivirus plasmid |
ORF Viral Vector | pGMLP005627 | Human E2F2 Lentivirus plasmid |
ORF Viral Vector | vGMLP001489 | Human E2F2 Lentivirus particle |
ORF Viral Vector | vGMLP005627 | Human E2F2 Lentivirus particle |
Target information
Target ID | GM-T16180 |
Target Name | E2F2 |
Gene ID | 1870, 242705, 710200, 684111, 101098067, 100855664, 617024, 100057866 |
Gene Symbol and Synonyms | E2F-2,E2F2 |
Uniprot Accession | Q14209 |
Uniprot Entry Name | E2F2_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Cancer |
Gene Ensembl | ENSG00000007968 |
Target Classification | Tumor-associated antigen (TAA) |
The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.