Human E2F2/E2F-2 ORF/cDNA clone-Lentivirus particle (NM_004091)

Cat. No.: vGMLP001489

Pre-made Human E2F2/E2F-2 Lentiviral expression plasmid for E2F2 lentivirus packaging, E2F2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to E2F2/E2F-2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001489 Human E2F2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001489
Gene Name E2F2
Accession Number NM_004091
Gene ID 1870
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 1314 bp
Gene Alias E2F-2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTGCAAGGGCCCCGGGCCTTGGCTTCGGCCGCTGGGCAGACCCCGAAGGTGGTGCCCGCGATGAGCCCCACAGAGCTGTGGCCATCCGGCCTCAGCAGCCCCCAGCTCTGCCCAGCTACTGCTACCTACTACACACCGCTGTACCCGCAGACGGCGCCTCCCGCAGCGGCGCCAGGCACCTGCCTCGACGCCACTCCCCACGGACCCGAGGGCCAAGTTGTGCGATGCCTGCCGGCAGGCCGGCTGCCGGCCAAAAGGAAGCTGGATCTGGAGGGGATTGGGAGGCCCGTCGTCCCTGAGTTCCCAACCCCCAAGGGGAAGTGCATCAGAGTGGATGGCCTCCCCAGCCCCAAAACCCCCAAATCCCCCGGGGAGAAGACTCGGTATGACACTTCGCTGGGGCTGCTCACCAAGAAGTTCATTTACCTCCTGAGCGAGTCAGAGGATGGGGTCCTGGACCTGAACTGGGCCGCTGAGGTGCTGGACGTGCAGAAGCGGCGCATCTATGACATCACCAACGTGCTGGAAGGCATCCAGCTCATCCGCAAGAAGGCCAAGAACAACATCCAGTGGGTAGGCAGGGGAATGTTTGAAGACCCCACCAGACCTGGGAAGCAGCAACAGCTGGGGCAGGAGCTGAAGGAGCTGATGAACACGGAGCAGGCCTTGGACCAGCTCATCCAGAGCTGCTCTCTGAGCTTCAAGCACCTGACTGAGGACAAGGCCAACAAGAGGCTGGCCTATGTGACTTACCAGGATATCCGTGCTGTTGGCAACTTTAAGGAGCAGACAGTGATTGCCGTCAAGGCCCCTCCGCAGACGAGACTGGAAGTGCCCGACAGGACTGAGGACAACCTGCAGATATATCTCAAGAGCACCCAAGGGCCCATCGAAGTCTACCTGTGCCCAGAGGAGGTGCAGGAGCCGGACAGTCCTTCCGAGGAGCCTCTCCCCTCTACCTCCACCCTCTGCCCCAGCCCTGACTCTGCCCAGCCCAGCAGCAGCACCGACCCTAGCATCATGGAGCCCACAGCATCCTCAGTGCCAGCACCAGCGCCAACCCCCCAGCAGGCCCCACCGCCTCCATCCCTGGTCCCCTTGGAGGCTACTGACAGCCTGCTGGAGCTGCCGCACCCACTCCTGCAGCAGACTGAGGACCAGTTCCTGTCCCCGACCCTGGCGTGCAGCTCCCCTCTGATCAGCTTCTCCCCATCCTTGGACCAGGACGACTACCTGTGGGGCTTGGAGGCGGGTGAGGGCATCAGCGATCTCTTCGACTCCTACGACCTTGGGGACCTGTTGATTAATTGA
ORF Protein Sequence MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPGTCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALDQLIQSCSLSFKHLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEVYLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAPPPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLIN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T16180-Ab Anti-E2F2 monoclonal antibody
    Target Antigen GM-Tg-g-T16180-Ag E2F2 protein
    ORF Viral Vector pGMLP001489 Human E2F2 Lentivirus plasmid
    ORF Viral Vector pGMLP005627 Human E2F2 Lentivirus plasmid
    ORF Viral Vector vGMLP001489 Human E2F2 Lentivirus particle
    ORF Viral Vector vGMLP005627 Human E2F2 Lentivirus particle


    Target information

    Target ID GM-T16180
    Target Name E2F2
    Gene ID 1870, 242705, 710200, 684111, 101098067, 100855664, 617024, 100057866
    Gene Symbol and Synonyms E2F-2,E2F2
    Uniprot Accession Q14209
    Uniprot Entry Name E2F2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000007968
    Target Classification Tumor-associated antigen (TAA)

    The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.