Human RUNX3/AML2/CBFA3 ORF/cDNA clone-Lentivirus plasmid (NM_004350)

Cat. No.: pGMLP001563
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RUNX3/AML2/CBFA3 Lentiviral expression plasmid for RUNX3 lentivirus packaging, RUNX3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to RUNX3/AML2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $649.44
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001563
Gene Name RUNX3
Accession Number NM_004350
Gene ID 864
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1248 bp
Gene Alias AML2,CBFA3,PEBP2aC
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGTATTCCCGTAGACCCAAGCACCAGCCGCCGCTTCACACCTCCCTCCCCGGCCTTCCCCTGCGGCGGCGGCGGCGGCAAGATGGGCGAGAACAGCGGCGCGCTGAGCGCGCAGGCGGCCGTGGGGCCCGGAGGGCGCGCCCGGCCCGAGGTGCGCTCGATGGTGGACGTGCTGGCGGACCACGCAGGCGAGCTCGTGCGCACCGACAGCCCCAACTTCCTCTGCTCCGTGCTGCCCTCGCACTGGCGCTGCAACAAGACGCTGCCCGTCGCCTTCAAGGTGGTGGCATTGGGGGACGTGCCGGATGGTACGGTGGTGACTGTGATGGCAGGCAATGACGAGAACTACTCCGCTGAGCTGCGCAATGCCTCGGCCGTCATGAAGAACCAGGTGGCCAGGTTCAACGACCTTCGCTTCGTGGGCCGCAGTGGGCGAGGGAAGAGTTTCACCCTGACCATCACTGTGTTCACCAACCCCACCCAAGTGGCGACCTACCACCGAGCCATCAAGGTGACCGTGGACGGACCCCGGGAGCCCAGACGGCACCGGCAGAAGCTGGAGGACCAGACCAAGCCGTTCCCTGACCGCTTTGGGGACCTGGAACGGCTGCGCATGCGGGTGACACCGAGCACACCCAGCCCCCGAGGCTCACTCAGCACCACAAGCCACTTCAGCAGCCAGCCCCAGACCCCAATCCAAGGCACCTCGGAACTGAACCCATTCTCCGACCCCCGCCAGTTTGACCGCTCCTTCCCCACGCTGCCAACCCTCACGGAGAGCCGCTTCCCAGACCCCAGGATGCATTATCCCGGGGCCATGTCAGCTGCCTTCCCCTACAGCGCCACGCCCTCGGGCACGAGCATCAGCAGCCTCAGCGTGGCGGGCATGCCGGCCACCAGCCGCTTCCACCATACCTACCTCCCGCCACCCTACCCGGGGGCCCCGCAGAACCAGAGCGGGCCCTTCCAGGCCAACCCGTCCCCCTACCACCTCTACTACGGGACATCCTCTGGCTCCTACCAGTTCTCCATGGTGGCCGGCAGCAGCAGTGGGGGCGACCGCTCACCTACCCGCATGCTGGCCTCTTGCACCAGCAGCGCTGCCTCTGTCGCCGCCGGCAACCTCATGAACCCCAGCCTGGGCGGCCAGAGTGATGGCGTGGAGGCCGACGGCAGCCACAGCAACTCACCCACGGCCCTGAGCACGCCAGGCCGCATGGATGAGGCCGTGTGGCGGCCCTACTGA
ORF Protein Sequence MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T29630-Ab Anti-RUNX3 monoclonal antibody
    Target Antigen GM-Tg-g-T29630-Ag RUNX3 protein
    ORF Viral Vector pGMLP001563 Human RUNX3 Lentivirus plasmid
    ORF Viral Vector pGMLV001763 Human RUNX3 Lentivirus plasmid
    ORF Viral Vector vGMLP001563 Human RUNX3 Lentivirus particle
    ORF Viral Vector vGMLV001763 Human RUNX3 Lentivirus particle


    Target information

    Target ID GM-T29630
    Target Name RUNX3
    Gene ID 864, 12399, 719447, 156726, 101080466, 119870408, 617389, 100071400
    Gene Symbol and Synonyms AML2,CBFA3,Pebp2a3,PEBP2aC,RUNX3,Rx3
    Uniprot Accession Q13761
    Uniprot Entry Name RUNX3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Esophagus Cancer
    Gene Ensembl ENSG00000020633
    Target Classification Not Available

    This gene encodes a member of the runt domain-containing family of transcription factors. A heterodimer of this protein and a beta subunit forms a complex that binds to the core DNA sequence 5'-PYGPYGGT-3' found in a number of enhancers and promoters, and can either activate or suppress transcription. It also interacts with other transcription factors. It functions as a tumor suppressor, and the gene is frequently deleted or transcriptionally silenced in cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.