Human RAD51B/R51H2/RAD51L1 ORF/cDNA clone-Lentivirus plasmid (NM_133509)
Cat. No.: pGMLP001722
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human RAD51B/R51H2/RAD51L1 Lentiviral expression plasmid for RAD51B lentivirus packaging, RAD51B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
RAD51B/R51H2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP001722 |
Gene Name | RAD51B |
Accession Number | NM_133509 |
Gene ID | 5890 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 1155 bp |
Gene Alias | R51H2,RAD51L1,REC2 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGGTAGCAAGAAACTAAAACGAGTGGGTTTATCACAAGAGCTGTGTGACCGTCTGAGTAGACATCAGATCCTTACCTGTCAGGACTTTTTATGTCTTTCCCCACTGGAGCTTATGAAGGTGACTGGTCTGAGTTATCGAGGTGTCCATGAACTTCTATGTATGGTCAGCAGGGCCTGTGCCCCAAAGATGCAAACGGCTTATGGGATAAAAGCACAAAGGTCTGCTGATTTCTCACCAGCATTCTTATCTACTACCCTTTCTGCTTTGGACGAAGCCCTGCATGGTGGTGTGGCTTGTGGATCCCTCACAGAGATTACAGGTCCACCAGGTTGTGGAAAAACTCAGTTTTGTATAATGATGAGCATTTTGGCTACATTACCCACCAACATGGGAGGATTAGAAGGAGCTGTGGTGTACATTGACACAGAGTCTGCATTTAGTGCTGAAAGACTGGTTGAAATAGCAGAATCCCGTTTTCCCAGATATTTTAACACTGAAGAAAAGTTACTTTTGACAAGTAGTAAAGTTCATCTTTATCGGGAACTCACCTGTGATGAAGTTCTACAAAGGATTGAATCTTTGGAAGAAGAAATTATCTCAAAAGGAATTAAACTTGTGATTCTTGACTCTGTTGCTTCTGTGGTCAGAAAGGAGTTTGATGCACAACTTCAAGGCAATCTCAAAGAAAGAAACAAGTTCTTGGCAAGAGAGGCATCCTCCTTGAAGTATTTGGCTGAGGAGTTTTCAATCCCAGTTATCTTGACGAATCAGATTACAACCCATCTGAGTGGAGCCCTGGCTTCTCAGGCAGACCTGGTGTCTCCAGCTGATGATTTGTCCCTGTCTGAAGGCACTTCTGGATCCAGCTGTGTGATAGCCGCACTAGGAAATACCTGGAGTCACAGTGTGAATACCCGGCTGATCCTCCAGTACCTTGATTCAGAGAGAAGACAGATTCTTATTGCCAAGTCCCCTCTGGCTCCCTTCACCTCATTTGTCTACACCATCAAGGAGGAAGGCCTGGTTCTTCAAGAGACAACATTTTGCTCTGTCACCCAAGCTGAACTGAACTGGGCTCCAGAAATCCTCCCACCTCAGCCTCCTGAGCAGCTAGGACTACAGATGTGCCACCATACCCAGCTAATTTTTTAA |
ORF Protein Sequence | MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP1468-Ab | Anti-RAD51B monoclonal antibody |
Target Antigen | GM-Tg-g-IP1468-Ag | RAD51B protein |
ORF Viral Vector | pGMLP001722 | Human RAD51B Lentivirus plasmid |
ORF Viral Vector | vGMLP001722 | Human RAD51B Lentivirus particle |
Target information
Target ID | GM-IP1468 |
Target Name | RAD51B |
Gene ID | 5890, 19363, 711358, 500679, 101097071, 490746, 617007, 100053023 |
Gene Symbol and Synonyms | mREC2,R51H2,RAD51B,RAD51L1,REC2,RGD1560681 |
Uniprot Accession | O15315 |
Uniprot Entry Name | RA51B_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Cancer |
Gene Ensembl | ENSG00000182185 |
Target Classification | Tumor-associated antigen (TAA) |
The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are evolutionarily conserved proteins essential for DNA repair by homologous recombination. This protein has been shown to form a stable heterodimer with the family member RAD51C, which further interacts with the other family members, such as RAD51, XRCC2, and XRCC3. Overexpression of this gene was found to cause cell cycle G1 delay and cell apoptosis, which suggested a role of this protein in sensing DNA damage. Rearrangements between this locus and high mobility group AT-hook 2 (HMGA2, GeneID 8091) have been observed in uterine leiomyomata. [provided by RefSeq, Mar 2016]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.