Human RAD51B/R51H2/RAD51L1 ORF/cDNA clone-Lentivirus plasmid (NM_133509)

Cat. No.: pGMLP001722
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RAD51B/R51H2/RAD51L1 Lentiviral expression plasmid for RAD51B lentivirus packaging, RAD51B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to RAD51B/R51H2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $623.4
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001722
Gene Name RAD51B
Accession Number NM_133509
Gene ID 5890
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1155 bp
Gene Alias R51H2,RAD51L1,REC2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGTAGCAAGAAACTAAAACGAGTGGGTTTATCACAAGAGCTGTGTGACCGTCTGAGTAGACATCAGATCCTTACCTGTCAGGACTTTTTATGTCTTTCCCCACTGGAGCTTATGAAGGTGACTGGTCTGAGTTATCGAGGTGTCCATGAACTTCTATGTATGGTCAGCAGGGCCTGTGCCCCAAAGATGCAAACGGCTTATGGGATAAAAGCACAAAGGTCTGCTGATTTCTCACCAGCATTCTTATCTACTACCCTTTCTGCTTTGGACGAAGCCCTGCATGGTGGTGTGGCTTGTGGATCCCTCACAGAGATTACAGGTCCACCAGGTTGTGGAAAAACTCAGTTTTGTATAATGATGAGCATTTTGGCTACATTACCCACCAACATGGGAGGATTAGAAGGAGCTGTGGTGTACATTGACACAGAGTCTGCATTTAGTGCTGAAAGACTGGTTGAAATAGCAGAATCCCGTTTTCCCAGATATTTTAACACTGAAGAAAAGTTACTTTTGACAAGTAGTAAAGTTCATCTTTATCGGGAACTCACCTGTGATGAAGTTCTACAAAGGATTGAATCTTTGGAAGAAGAAATTATCTCAAAAGGAATTAAACTTGTGATTCTTGACTCTGTTGCTTCTGTGGTCAGAAAGGAGTTTGATGCACAACTTCAAGGCAATCTCAAAGAAAGAAACAAGTTCTTGGCAAGAGAGGCATCCTCCTTGAAGTATTTGGCTGAGGAGTTTTCAATCCCAGTTATCTTGACGAATCAGATTACAACCCATCTGAGTGGAGCCCTGGCTTCTCAGGCAGACCTGGTGTCTCCAGCTGATGATTTGTCCCTGTCTGAAGGCACTTCTGGATCCAGCTGTGTGATAGCCGCACTAGGAAATACCTGGAGTCACAGTGTGAATACCCGGCTGATCCTCCAGTACCTTGATTCAGAGAGAAGACAGATTCTTATTGCCAAGTCCCCTCTGGCTCCCTTCACCTCATTTGTCTACACCATCAAGGAGGAAGGCCTGGTTCTTCAAGAGACAACATTTTGCTCTGTCACCCAAGCTGAACTGAACTGGGCTCCAGAAATCCTCCCACCTCAGCCTCCTGAGCAGCTAGGACTACAGATGTGCCACCATACCCAGCTAATTTTTTAA
ORF Protein Sequence MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1468-Ab Anti-RAD51B monoclonal antibody
    Target Antigen GM-Tg-g-IP1468-Ag RAD51B protein
    ORF Viral Vector pGMLP001722 Human RAD51B Lentivirus plasmid
    ORF Viral Vector vGMLP001722 Human RAD51B Lentivirus particle


    Target information

    Target ID GM-IP1468
    Target Name RAD51B
    Gene ID 5890, 19363, 711358, 500679, 101097071, 490746, 617007, 100053023
    Gene Symbol and Synonyms mREC2,R51H2,RAD51B,RAD51L1,REC2,RGD1560681
    Uniprot Accession O15315
    Uniprot Entry Name RA51B_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000182185
    Target Classification Tumor-associated antigen (TAA)

    The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are evolutionarily conserved proteins essential for DNA repair by homologous recombination. This protein has been shown to form a stable heterodimer with the family member RAD51C, which further interacts with the other family members, such as RAD51, XRCC2, and XRCC3. Overexpression of this gene was found to cause cell cycle G1 delay and cell apoptosis, which suggested a role of this protein in sensing DNA damage. Rearrangements between this locus and high mobility group AT-hook 2 (HMGA2, GeneID 8091) have been observed in uterine leiomyomata. [provided by RefSeq, Mar 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.