Human ENDOU/P11/PP11 ORF/cDNA clone-Lentivirus plasmid (NM_006025)

Cat. No.: pGMLP001772
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ENDOU/P11/PP11 Lentiviral expression plasmid for ENDOU lentivirus packaging, ENDOU lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to ENDOU/P11 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $610.8
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001772
Gene Name ENDOU
Accession Number NM_006025
Gene ID 8909
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1110 bp
Gene Alias P11,PP11,PRSS26
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGGCCTGCATCTCCCTGGTATTGGCCGTGCTGTGTGGCCTGGCCTGGGCTGAGGACCACAAAGAGTCAGAGCCATTGCCACAGCTGGAGGAAGAGACAGAAGAGGCCCTCGCCAGCAACTTGTACTCGGCACCCACCTCCTGCCAGGGCCGCTGCTACGAAGCCTTTGACAAGCACCACCAATGTCACTGCAATGCCCGCTGCCAAGAGTTTGGGAACTGCTGCAAGGATTTTGAGAGCCTGTGTAGTGACCACGAGGTCTCCCACAGCAGTGATGCCATAACAAAAGAGGAGATTCAGAGCATCTCTGAGAAGATCTACAGGGCAGACACCAACAAAGCCCAGAAGGAAGACATCGTTCTCAATAGCCAAAACTGCATCTCCCCGTCAGAGACCAGAAACCAAGTGGATCGCTGCCCAAAGCCACTCTTCACTTATGTCAATGAGAAGCTGTTCTCCAAGCCCACCTATGCAGCCTTCATCAACCTCCTCAACAACTACCAGCGGGCAACAGGCCATGGGGAGCACTTCAGTGCCCAGGAGCTGGCCGAGCAGGACGCCTTCCTCAGAGAGATCATGAAGACAGCAGTCATGAAGGAGCTCTACAGCTTCCTCCATCACCAGAATCGCTATGGCTCAGAGCAAGAGTTTGTCGATGACTTGAAGAACATGTGGTTTGGGCTCTATTCAAGAGGCAATGAAGAGGGGGACTCGAGTGGCTTTGAACATGTCTTCTCAGGTGAGGTAAAAAAAGGCAAGGTTACTGGCTTCCATAACTGGATCCGCTTCTACCTGGAGGAGAAGGAGGGTCTGGTTGACTATTACAGTCACATCTACGATGGGCCTTGGGATTCTTACCCCGATGTGCTGGCAATGCAGTTCAACTGGGACGGCTACTATAAGGAAGTGGGCTCTGCTTTCATCGGCAGCAGCCCTGAGTTTGAGTTTGCACTCTACTCCCTGTGCTTCATCGCCAGGCCAGGCAAAGTGTGCCAGTTAAGCCTGGGAGGATATCCCTTAGCTGTCCGGACATATACCTGGGACAAGTCCACCTATGGGAATGGCAAGAAGTACATCGCCACAGCCTACATAGTGTCTTCCACCTAA
ORF Protein Sequence MRACISLVLAVLCGLAWAEDHKESEPLPQLEEETEEALASNLYSAPTSCQGRCYEAFDKHHQCHCNARCQEFGNCCKDFESLCSDHEVSHSSDAITKEEIQSISEKIYRADTNKAQKEDIVLNSQNCISPSETRNQVDRCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAVMKELYSFLHHQNRYGSEQEFVDDLKNMWFGLYSRGNEEGDSSGFEHVFSGEVKKGKVTGFHNWIRFYLEEKEGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFALYSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKYIATAYIVSST

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2432-Ab Anti-ENDOU/ P11/ PP11 monoclonal antibody
    Target Antigen GM-Tg-g-MP2432-Ag ENDOU VLP (virus-like particle)
    ORF Viral Vector pGMLP001772 Human ENDOU Lentivirus plasmid
    ORF Viral Vector vGMLP001772 Human ENDOU Lentivirus particle


    Target information

    Target ID GM-MP2432
    Target Name ENDOU
    Gene ID 8909, 19011, 703854, 680317, 101084802, 111092916, 525399, 100056519
    Gene Symbol and Synonyms ENDOU,P11,PP11,Pp11r,PRSS26,Tcl-30
    Uniprot Accession P21128
    Uniprot Entry Name ENDOU_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000111405
    Target Classification Tumor-associated antigen (TAA)

    This gene encodes a protein with endoribonuclease activity that binds polyuridine-enriched single-stranded RNA. This gene was initially characterized based on its high expression in placenta but was mischaracterized as a serine protease. In mouse, this gene promotes tolerance to self-antigens by regulating B cell activation-induced cell death (AICD). The protein may be useful as a tumor marker. Multiple alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene. [provided by RefSeq, Jul 2020]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.