Human MT1G/MT1/MT1K ORF/cDNA clone-Lentivirus plasmid (NM_005950)

Cat. No.: pGMLP001819
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MT1G/MT1/MT1K Lentiviral expression plasmid for MT1G lentivirus packaging, MT1G lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to MT1G/MT1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001819
Gene Name MT1G
Accession Number NM_005950
Gene ID 4495
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 186 bp
Gene Alias MT1,MT1K
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGACCCCAACTGCTCCTGTGCCGCTGGTGTCTCCTGCACCTGCGCCAGCTCCTGCAAGTGCAAAGAGTGCAAATGCACCTCCTGCAAGAAGAGCTGCTGCTCCTGCTGCCCTGTGGGCTGTGCCAAGTGTGCCCAGGGCTGCATCTGCAAAGGGGCATCGGAGAAGTGCAGCTGCTGCGCCTGA
ORF Protein Sequence MDPNCSCAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCCA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1484-Ab Anti-MT1G/ MT1/ MT1K functional antibody
    Target Antigen GM-Tg-g-SE1484-Ag MT1G protein
    ORF Viral Vector pGMLP001819 Human MT1G Lentivirus plasmid
    ORF Viral Vector vGMLP001819 Human MT1G Lentivirus particle


    Target information

    Target ID GM-SE1484
    Target Name MT1G
    Gene ID 4495
    Gene Symbol and Synonyms MT1,MT1G,MT1K
    Uniprot Accession P13640
    Uniprot Entry Name MT1G_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000125144
    Target Classification Tumor-associated antigen (TAA)

    Enables zinc ion binding activity. Involved in cellular response to metal ion; cellular response to vascular endothelial growth factor stimulus; and negative regulation of growth. Located in cytoplasm and nucleus. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.