Human MT1G/MT1/MT1K ORF/cDNA clone-Lentivirus particle (NM_005950)
Cat. No.: vGMLP001819
Pre-made Human MT1G/MT1/MT1K Lentiviral expression plasmid for MT1G lentivirus packaging, MT1G lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
MT1G/MT1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP001819 | Human MT1G Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP001819 |
| Gene Name | MT1G |
| Accession Number | NM_005950 |
| Gene ID | 4495 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 186 bp |
| Gene Alias | MT1,MT1K |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGACCCCAACTGCTCCTGTGCCGCTGGTGTCTCCTGCACCTGCGCCAGCTCCTGCAAGTGCAAAGAGTGCAAATGCACCTCCTGCAAGAAGAGCTGCTGCTCCTGCTGCCCTGTGGGCTGTGCCAAGTGTGCCCAGGGCTGCATCTGCAAAGGGGCATCGGAGAAGTGCAGCTGCTGCGCCTGA |
| ORF Protein Sequence | MDPNCSCAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCCA |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE1484-Ab | Anti-MT1G/ MT1/ MT1K functional antibody |
| Target Antigen | GM-Tg-g-SE1484-Ag | MT1G protein |
| ORF Viral Vector | pGMLP001819 | Human MT1G Lentivirus plasmid |
| ORF Viral Vector | vGMLP001819 | Human MT1G Lentivirus particle |
Target information
| Target ID | GM-SE1484 |
| Target Name | MT1G |
| Gene ID | 4495 |
| Gene Symbol and Synonyms | MT1,MT1G,MT1K |
| Uniprot Accession | P13640 |
| Uniprot Entry Name | MT1G_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Not Available |
| Disease | Cancer |
| Gene Ensembl | ENSG00000125144 |
| Target Classification | Tumor-associated antigen (TAA) |
Enables zinc ion binding activity. Involved in cellular response to metal ion; cellular response to vascular endothelial growth factor stimulus; and negative regulation of growth. Located in cytoplasm and nucleus. [provided by Alliance of Genome Resources, Apr 2022]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


