Human Tor2a/TORP1 ORF/cDNA clone-Lentivirus plasmid (NM_001134431)

Cat. No.: pGMLP001854
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human Tor2a/TORP1 Lentiviral expression plasmid for Tor2a lentivirus packaging, Tor2a lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to TOR2A/Tor2a/TORP1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001854
Gene Name Tor2a
Accession Number NM_001134431
Gene ID 27433
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 219 bp
Gene Alias TORP1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCTGCGACGCGCGGCTGCCGGCCCTGGGGCTCGCTCCTCGGGCTGCTCGGGCTGGTCTCGGCCGCGGCCGCCGCCTGGGACCTGGCTTCCCTGCGCTGCACCTTGGGCGCCTTTTGCGAATGCGACTTCCGGCCCGACTTGCCGGAAGGATCTGAAGAGCTGGGTCCAAGGGAACCTCACTGCCTGTGGCCGCTCCCTCTTCCTCTTCGATGA
ORF Protein Sequence MAAATRGCRPWGSLLGLLGLVSAAAAAWDLASLRCTLGAFCECDFRPDLPEGSEELGPREPHCLWPLPLPLR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0522-Ab Anti-TOR2X/ TOR2A/ TOR2A functional antibody
    Target Antigen GM-Tg-g-SE0522-Ag TOR2A protein
    ORF Viral Vector pGMLP001854 Human Tor2a Lentivirus plasmid
    ORF Viral Vector vGMLP001854 Human Tor2a Lentivirus particle


    Target information

    Target ID GM-SE0522
    Target Name TOR2A
    Gene ID 27433, 30933, 700203, 362112, 101092305, 609191, 534311, 100070462
    Gene Symbol and Synonyms Prosalusin,TOR2A,TORP1,Torsin-2A
    Uniprot Accession Q8N2E6, Q5JU69
    Uniprot Entry Name TOR2X_HUMAN,TOR2A_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000160404
    Target Classification Not Available

    This gene encodes a member of the AAA family of adenosine triphosphatases with similarity to Clp proteases and heat shock proteins. Alternative splicing at this locus results in the translation of multiple isoforms of the encoded protein, some of which contain salusin peptides in the C-terminal region. These peptides may play roles in hypotension, myocardial growth and the induction of mitogenesis, and may also be involved in the pathogenesis of atherosclerosis. The antimicrobial peptide salusin-beta has antibacterial activity. [provided by RefSeq, Nov 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.