Human NMS ORF/cDNA clone-Lentivirus plasmid (NM_001011717)

Cat. No.: pGMLP001873
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human NMS/ Lentiviral expression plasmid for NMS lentivirus packaging, NMS lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to NMS/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001873
Gene Name NMS
Accession Number NM_001011717
Gene ID 129521
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 462 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAACATCTTCGTCCCCAGTTCCCTCTCATCTTGGCCATCTACTGCTTCTGCATGCTACAGATTCCCTCCTCAGGATTTCCTCAACCTTTAGCTGATCCTTCAGATGGCTTGGATATTGTGCAGCTTGAGCAGCTGGCATATTGTCTGAGTCAGTGGGCACCTCTTTCTCGCCAACCTAAGGATAATCAAGACATATACAAAAGGTTTTTGTTTCACTACTCCAGAACTCAGGAGGCAACACATCCAGTTAAAACTGGGTTTCCTCCAGTGCATCCTCTAATGCACCTGGCTGCCAAGCTCGCCAACAGGCGGATGAAGAGAATTCTGCAGCGAGGCTCGGGGACTGCTGCAGTGGACTTCACCAAGAAGGATCACACTGCGACCTGGGGACGACCCTTTTTCCTTTTCAGGCCCAGGAATGGAAGAAACATTGAAGATGAGGCCCAGATTCAGTGGTGA
ORF Protein Sequence MKHLRPQFPLILAIYCFCMLQIPSSGFPQPLADPSDGLDIVQLEQLAYCLSQWAPLSRQPKDNQDIYKRFLFHYSRTQEATHPVKTGFPPVHPLMHLAAKLANRRMKRILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRNGRNIEDEAQIQW

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1127-Ab Anti-NMS functional antibody
    Target Antigen GM-Tg-g-SE1127-Ag NMS protein
    ORF Viral Vector pGMLP001873 Human NMS Lentivirus plasmid
    ORF Viral Vector vGMLP001873 Human NMS Lentivirus particle


    Target information

    Target ID GM-SE1127
    Target Name NMS
    Gene ID 129521, 433292, 710021, 497196, 101086135, 474554, 768331, 100630166
    Gene Symbol and Synonyms NMS
    Uniprot Accession Q5H8A3
    Uniprot Entry Name NMS_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000204640
    Target Classification Not Available

    This gene encodes a member of the neuromedin family of neuropeptides. The encoded preproprotein is proteolytically processed to generate a biologically active neuropeptide that plays a role in the regulation of circadian rhythm, anorexigenic action, antidiuretic action, cardiovascular function and stimulation of oxytocin and vasopressin release. 



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.