Human CISD1/C10orf70/MDS029 ORF/cDNA clone-Lentivirus plasmid (NM_018464.4 )

Cat. No.: pGMLP001926
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CISD1/C10orf70/MDS029 Lentiviral expression plasmid for CISD1 lentivirus packaging, CISD1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CISD1/C10orf70 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001926
Gene Name CISD1
Accession Number NM_018464.4
Gene ID 55847
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 327 bp
Gene Alias C10orf70,MDS029,mitoNEET,ZCD1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGTCTGACTTCCAGTTCCAGCGTACGAGTTGAATGGATCGCAGCAGTTACCATTGCTGCTGGGACAGCTGCAATTGGTTATCTAGCTTACAAAAGATTTTATGTTAAAGATCATCGAAATAAAGCTATGATAAACCTTCACATCCAGAAAGACAACCCCAAGATAGTACATGCTTTTGACATGGAGGATTTGGGAGATAAAGCTGTGTACTGCCGTTGTTGGAGGTCCAAAAAGTTCCCATTCTGTGATGGGGCTCACACAAAACATAACGAAGAGACTGGAGACAATGTGGGCCCTCTGATCATCAAGAAAAAAGAAACTTAA
ORF Protein Sequence MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0550-Ab Anti-CISD1 monoclonal antibody
    Target Antigen GM-Tg-g-IP0550-Ag CISD1 protein
    ORF Viral Vector pGMLP001926 Human CISD1 Lentivirus plasmid
    ORF Viral Vector pGMLV002129 Human CISD1 Lentivirus plasmid
    ORF Viral Vector pGMLV002236 Human CISD1 Lentivirus plasmid
    ORF Viral Vector vGMLP001926 Human CISD1 Lentivirus particle
    ORF Viral Vector vGMLV002129 Human CISD1 Lentivirus particle
    ORF Viral Vector vGMLV002236 Human CISD1 Lentivirus particle


    Target information

    Target ID GM-IP0550
    Target Name CISD1
    Gene ID 55847, 52637, 701716, 294362, 101096415, 119871454, 531444, 100072162
    Gene Symbol and Synonyms C10orf70,CISD1,D10Ertd214e,MDS029,mitoNEET,RGD1309529,ZCD1
    Uniprot Accession Q9NZ45
    Uniprot Entry Name CISD1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000122873
    Target Classification Tumor-associated antigen (TAA)

    This gene encodes a protein with a CDGSH iron-sulfur domain and has been shown to bind a redox-active [2Fe-2S] cluster. The encoded protein has been localized to the outer membrane of mitochondria and is thought to play a role in regulation of oxidation. Genes encoding similar proteins are located on chromosomes 4 and 17, and a pseudogene of this gene is located on chromosome 2. [provided by RefSeq, Feb 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.