Human CISD1/C10orf70/MDS029 ORF/cDNA clone-Lentivirus plasmid (NM_018464.5)
Cat. No.: pGMLV002236
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CISD1/C10orf70/MDS029 Lentiviral expression plasmid for CISD1 lentivirus packaging, CISD1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
CISD1/C10orf70 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLV002236 |
Gene Name | CISD1 |
Accession Number | NM_018464.5 |
Gene ID | 55847 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 327 bp |
Gene Alias | C10orf70,MDS029,mitoNEET,ZCD1 |
Fluorescent Reporter | mCherry |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAGTCTGACTTCCAGTTCCAGCGTACGAGTTGAATGGATCGCAGCAGTTACCATTGCTGCTGGGACAGCTGCAATTGGTTATCTAGCTTACAAAAGATTTTATGTTAAAGATCATCGAAATAAAGCTATGATAAACCTTCACATCCAGAAAGACAACCCCAAGATAGTACATGCTTTTGACATGGAGGATTTGGGAGATAAAGCTGTGTACTGCCGTTGTTGGAGGTCCAAAAAGTTCCCATTCTGTGATGGGGCTCACACAAAACATAACGAAGAGACTGGAGACAATGTGGGCCCTCTGATCATCAAGAAAAAAGAAACTTAA |
ORF Protein Sequence | MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP0550-Ab | Anti-CISD1 monoclonal antibody |
Target Antigen | GM-Tg-g-IP0550-Ag | CISD1 protein |
ORF Viral Vector | pGMLP001926 | Human CISD1 Lentivirus plasmid |
ORF Viral Vector | pGMLV002129 | Human CISD1 Lentivirus plasmid |
ORF Viral Vector | pGMLV002236 | Human CISD1 Lentivirus plasmid |
ORF Viral Vector | vGMLP001926 | Human CISD1 Lentivirus particle |
ORF Viral Vector | vGMLV002129 | Human CISD1 Lentivirus particle |
ORF Viral Vector | vGMLV002236 | Human CISD1 Lentivirus particle |
Target information
Target ID | GM-IP0550 |
Target Name | CISD1 |
Gene ID | 55847, 52637, 701716, 294362, 101096415, 119871454, 531444, 100072162 |
Gene Symbol and Synonyms | C10orf70,CISD1,D10Ertd214e,MDS029,mitoNEET,RGD1309529,ZCD1 |
Uniprot Accession | Q9NZ45 |
Uniprot Entry Name | CISD1_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Cancer |
Gene Ensembl | ENSG00000122873 |
Target Classification | Tumor-associated antigen (TAA) |
This gene encodes a protein with a CDGSH iron-sulfur domain and has been shown to bind a redox-active [2Fe-2S] cluster. The encoded protein has been localized to the outer membrane of mitochondria and is thought to play a role in regulation of oxidation. Genes encoding similar proteins are located on chromosomes 4 and 17, and a pseudogene of this gene is located on chromosome 2. [provided by RefSeq, Feb 2012]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.