Human MIF/GIF/GLIF ORF/cDNA clone-Lentivirus plasmid (NM_002415.1)

Cat. No.: pGMLP001966
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MIF/GIF/GLIF Lentiviral expression plasmid for MIF lentivirus packaging, MIF lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to MIF/GIF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001966
Gene Name MIF
Accession Number NM_002415.1
Gene ID 4282
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 348 bp
Gene Alias GIF,GLIF,MMIF
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCGATGTTCATCGTAAACACCAACGTGCCCCGCGCCTCCGTGCCGGACGGGTTCCTCTCCGAGCTCACCCAGCAGCTGGCGCAGGCCACCGGCAAGCCCCCCCAGTACATCGCGGTGCACGTGGTCCCGGACCAGCTCATGGCCTTCGGCGGCTCCAGCGAGCCGTGCGCGCTCTGCAGCCTGCACAGCATCGGCAAGATCGGCGGCGCGCAGAACCGCTCCTACAGCAAGCTGCTGTGCGGCCTGCTGGCCGAGCGCCTGCGCATCAGCCCGGACAGGGTCTACATCAACTATTACGACATGAACGCGGCCAATGTGGGCTGGAACAACTCCACCTTCGCCTAA
ORF Protein Sequence MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-265 Pre-Made Imalumab biosimilar, Whole mAb, Anti-MIF Antibody: Anti-GIF/GLIF/MMIF therapeutic antibody
    Target Antibody GM-Tg-g-T39977-Ab Anti-MIF/ GIF/ GLIF monoclonal antibody
    Target Antigen GM-Tg-g-T39977-Ag MIF VLP (virus-like particle)
    ORF Viral Vector pGMLP001966 Human MIF Lentivirus plasmid
    ORF Viral Vector pGMAD001167 Human MIF Adenovirus plasmid
    ORF Viral Vector vGMLP001966 Human MIF Lentivirus particle
    ORF Viral Vector vGMAD001167 Human MIF Adenovirus particle


    Target information

    Target ID GM-T39977
    Target Name MIF
    Gene ID 4282, 17319, 574298, 81683, 101090298, 595146, 280858, 100053618
    Gene Symbol and Synonyms DER6,GIF,GLIF,MIF,MMIF
    Uniprot Accession P14174
    Uniprot Entry Name MIF_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target, INN Index
    Disease Ovary Cancer, Kidney transplant rejection, Congenital occlusion of ureteropelvic junction, Sepsis
    Gene Ensembl ENSG00000240972
    Target Classification Checkpoint-Immuno Oncology

    This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.