Human MIF/GIF/GLIF ORF/cDNA clone-Lentivirus plasmid (NM_002415.1)
Cat. No.: pGMLP001966
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human MIF/GIF/GLIF Lentiviral expression plasmid for MIF lentivirus packaging, MIF lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
MIF/GIF products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP001966 |
Gene Name | MIF |
Accession Number | NM_002415.1 |
Gene ID | 4282 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 348 bp |
Gene Alias | GIF,GLIF,MMIF |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCCGATGTTCATCGTAAACACCAACGTGCCCCGCGCCTCCGTGCCGGACGGGTTCCTCTCCGAGCTCACCCAGCAGCTGGCGCAGGCCACCGGCAAGCCCCCCCAGTACATCGCGGTGCACGTGGTCCCGGACCAGCTCATGGCCTTCGGCGGCTCCAGCGAGCCGTGCGCGCTCTGCAGCCTGCACAGCATCGGCAAGATCGGCGGCGCGCAGAACCGCTCCTACAGCAAGCTGCTGTGCGGCCTGCTGGCCGAGCGCCTGCGCATCAGCCCGGACAGGGTCTACATCAACTATTACGACATGAACGCGGCCAATGTGGGCTGGAACAACTCCACCTTCGCCTAA |
ORF Protein Sequence | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Biosimilar | GMP-Bios-ab-265 | Pre-Made Imalumab biosimilar, Whole mAb, Anti-MIF Antibody: Anti-GIF/GLIF/MMIF therapeutic antibody |
Target Antibody | GM-Tg-g-T39977-Ab | Anti-MIF/ GIF/ GLIF monoclonal antibody |
Target Antigen | GM-Tg-g-T39977-Ag | MIF VLP (virus-like particle) |
ORF Viral Vector | pGMLP001966 | Human MIF Lentivirus plasmid |
ORF Viral Vector | pGMAD001167 | Human MIF Adenovirus plasmid |
ORF Viral Vector | vGMLP001966 | Human MIF Lentivirus particle |
ORF Viral Vector | vGMAD001167 | Human MIF Adenovirus particle |
Target information
Target ID | GM-T39977 |
Target Name | MIF |
Gene ID | 4282, 17319, 574298, 81683, 101090298, 595146, 280858, 100053618 |
Gene Symbol and Synonyms | DER6,GIF,GLIF,MIF,MMIF |
Uniprot Accession | P14174 |
Uniprot Entry Name | MIF_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target, Immuno-oncology Target, INN Index |
Disease | Ovary Cancer, Kidney transplant rejection, Congenital occlusion of ureteropelvic junction, Sepsis |
Gene Ensembl | ENSG00000240972 |
Target Classification | Checkpoint-Immuno Oncology |
This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.