Human BAK1/BAK/BAK-LIKE ORF/cDNA clone-Lentivirus plasmid (NM_001188)

Cat. No.: pGMLP002040
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human BAK1/BAK/BAK-LIKE Lentiviral expression plasmid for BAK1 lentivirus packaging, BAK1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to BAK/BAK1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $459
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002040
Gene Name BAK1
Accession Number NM_001188
Gene ID 578
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 636 bp
Gene Alias BAK,BAK-LIKE,BCL2L7,CDN1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTTCGGGGCAAGGCCCAGGTCCTCCCAGGCAGGAGTGCGGAGAGCCTGCCCTGCCCTCTGCTTCTGAGGAGCAGGTAGCCCAGGACACAGAGGAGGTTTTCCGCAGCTACGTTTTTTACCGCCATCAGCAGGAACAGGAGGCTGAAGGGGTGGCTGCCCCTGCCGACCCAGAGATGGTCACCTTACCTCTGCAACCTAGCAGCACCATGGGGCAGGTGGGACGGCAGCTCGCCATCATCGGGGACGACATCAACCGACGCTATGACTCAGAGTTCCAGACCATGTTGCAGCACCTGCAGCCCACGGCAGAGAATGCCTATGAGTACTTCACCAAGATTGCCACCAGCCTGTTTGAGAGTGGCATCAATTGGGGCCGTGTGGTGGCTCTTCTGGGCTTCGGCTACCGTCTGGCCCTACACGTCTACCAGCATGGCCTGACTGGCTTCCTAGGCCAGGTGACCCGCTTCGTGGTCGACTTCATGCTGCATCACTGCATTGCCCGGTGGATTGCACAGAGGGGTGGCTGGGTGGCAGCCCTGAACTTGGGCAATGGTCCCATCCTGAACGTGCTGGTGGTTCTGGGTGTGGTTCTGTTGGGCCAGTTTGTGGTACGAAGATTCTTCAAATCATGA
ORF Protein Sequence MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0150-Ab Anti-BAK monoclonal antibody
    Target Antigen GM-Tg-g-IP0150-Ag BAK/BAK1 protein
    ORF Viral Vector pGMLP002040 Human BAK1 Lentivirus plasmid
    ORF Viral Vector vGMLP002040 Human BAK1 Lentivirus particle


    Target information

    Target ID GM-IP0150
    Target Name BAK
    Gene ID 578, 12018, 706534, 116502, 101093435, 481744, 514090, 100061755
    Gene Symbol and Synonyms BAK,BAK-LIKE,BAK1,BCL2L7,CDN1,N-Bak,N-BAK1
    Uniprot Accession Q16611
    Uniprot Entry Name BAK_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000030110
    Target Classification Tumor-associated antigen (TAA)

    The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.