Human BAK1/BAK/BAK-LIKE ORF/cDNA clone-Lentivirus particle (NM_001188)
Cat. No.: vGMLP002040
Pre-made Human BAK1/BAK/BAK-LIKE Lentiviral expression plasmid for BAK1 lentivirus packaging, BAK1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
BAK/BAK1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP002040 | Human BAK1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP002040 |
Gene Name | BAK1 |
Accession Number | NM_001188 |
Gene ID | 578 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 636 bp |
Gene Alias | BAK,BAK-LIKE,BCL2L7,CDN1 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCTTCGGGGCAAGGCCCAGGTCCTCCCAGGCAGGAGTGCGGAGAGCCTGCCCTGCCCTCTGCTTCTGAGGAGCAGGTAGCCCAGGACACAGAGGAGGTTTTCCGCAGCTACGTTTTTTACCGCCATCAGCAGGAACAGGAGGCTGAAGGGGTGGCTGCCCCTGCCGACCCAGAGATGGTCACCTTACCTCTGCAACCTAGCAGCACCATGGGGCAGGTGGGACGGCAGCTCGCCATCATCGGGGACGACATCAACCGACGCTATGACTCAGAGTTCCAGACCATGTTGCAGCACCTGCAGCCCACGGCAGAGAATGCCTATGAGTACTTCACCAAGATTGCCACCAGCCTGTTTGAGAGTGGCATCAATTGGGGCCGTGTGGTGGCTCTTCTGGGCTTCGGCTACCGTCTGGCCCTACACGTCTACCAGCATGGCCTGACTGGCTTCCTAGGCCAGGTGACCCGCTTCGTGGTCGACTTCATGCTGCATCACTGCATTGCCCGGTGGATTGCACAGAGGGGTGGCTGGGTGGCAGCCCTGAACTTGGGCAATGGTCCCATCCTGAACGTGCTGGTGGTTCTGGGTGTGGTTCTGTTGGGCCAGTTTGTGGTACGAAGATTCTTCAAATCATGA |
ORF Protein Sequence | MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP0150-Ab | Anti-BAK monoclonal antibody |
Target Antigen | GM-Tg-g-IP0150-Ag | BAK/BAK1 protein |
ORF Viral Vector | pGMLP002040 | Human BAK1 Lentivirus plasmid |
ORF Viral Vector | vGMLP002040 | Human BAK1 Lentivirus particle |
Target information
Target ID | GM-IP0150 |
Target Name | BAK |
Gene ID | 578, 12018, 706534, 116502, 101093435, 481744, 514090, 100061755 |
Gene Symbol and Synonyms | BAK,BAK-LIKE,BAK1,BCL2L7,CDN1,N-Bak,N-BAK1 |
Uniprot Accession | Q16611 |
Uniprot Entry Name | BAK_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Cancer |
Gene Ensembl | ENSG00000030110 |
Target Classification | Tumor-associated antigen (TAA) |
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.