Human C1QBP/COXPD33/gC1Q-R ORF/cDNA clone-Lentivirus plasmid (NM_001212)

Cat. No.: pGMLP002048
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human C1QBP/COXPD33/gC1Q-R Lentiviral expression plasmid for C1QBP lentivirus packaging, C1QBP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to C1QBP/COXPD33 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $512.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002048
Gene Name C1QBP
Accession Number NM_001212
Gene ID 708
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 849 bp
Gene Alias COXPD33,gC1Q-R,GC1QBP,gC1qR,HABP1,p32,SF2p32
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTGCCTCTGCTGCGCTGCGTGCCCCGTGTGCTGGGCTCCTCCGTCGCCGGCCTCCGCGCTGCCGCGCCCGCCTCGCCTTTCCGGCAGCTCCTGCAGCCGGCACCCCGGCTGTGCACCCGGCCCTTCGGGCTGCTCAGCGTGCGCGCAGGTTCCGAGCGGCGGCCGGGCCTCCTGCGGCCTCGCGGACCCTGCGCCTGTGGCTGTGGCTGCGGCTCGCTGCACACCGACGGAGACAAAGCTTTTGTTGATTTCCTGAGTGATGAAATTAAGGAGGAAAGAAAAATTCAGAAGCATAAAACCCTCCCTAAGATGTCTGGAGGTTGGGAGCTGGAACTGAATGGGACAGAAGCGAAATTAGTGCGGAAAGTTGCCGGGGAAAAAATCACGGTCACTTTCAACATTAACAACAGCATCCCACCAACATTTGATGGTGAGGAGGAACCCTCGCAAGGGCAGAAGGTTGAAGAACAGGAGCCTGAACTGACATCAACTCCCAATTTCGTGGTTGAAGTTATAAAGAATGATGATGGCAAGAAGGCCCTTGTGTTGGACTGTCATTATCCAGAGGATGAGGTTGGACAAGAAGACGAGGCTGAGAGTGACATCTTCTCTATCAGGGAAGTTAGCTTTCAGTCCACTGGCGAGTCTGAATGGAAGGATACTAATTATACACTCAACACAGATTCCTTGGACTGGGCCTTATATGACCACCTAATGGATTTCCTTGCCGACCGAGGGGTGGACAACACTTTTGCAGATGAGCTGGTGGAGCTCAGCACAGCCCTGGAGCACCAGGAGTACATTACTTTTCTTGAAGACCTCAAGAGTTTTGTCAAGAGCCAGTAG
ORF Protein Sequence MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T69192-Ab Anti-C1QBP/ COXPD33/ GC1QBP monoclonal antibody
    Target Antigen GM-Tg-g-T69192-Ag C1QBP VLP (virus-like particle)
    ORF Viral Vector pGMLP002048 Human C1QBP Lentivirus plasmid
    ORF Viral Vector vGMLP002048 Human C1QBP Lentivirus particle


    Target information

    Target ID GM-T69192
    Target Name C1QBP
    Gene ID 708, 12261, 711817, 29681, 101089553, 489450, 518321, 100072802
    Gene Symbol and Synonyms C1QBP,COXPD33,D11Wsu182e,gC1Q-R,GC1QBP,gC1qR,HABP1,p32,SF2AP32,SF2p32
    Uniprot Accession Q07021
    Uniprot Entry Name C1QBP_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Prostate Cancer
    Gene Ensembl ENSG00000108561
    Target Classification Not Available

    The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.