Human DKK4/DKK-4 ORF/cDNA clone-Lentivirus plasmid (NM_014420)

Cat. No.: pGMLP002081
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human DKK4/DKK-4 Lentiviral expression plasmid for DKK4 lentivirus packaging, DKK4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to DKK4/DKK-4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $468.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002081
Gene Name DKK4
Accession Number NM_014420
Gene ID 27121
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 675 bp
Gene Alias DKK-4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTGGCGGCCGTCCTGCTGGGGCTGAGCTGGCTCTGCTCTCCCCTGGGAGCTCTGGTCCTGGACTTCAACAACATCAGGAGCTCTGCTGACCTGCATGGGGCCCGGAAGGGCTCACAGTGCCTGTCTGACACGGACTGCAATACCAGAAAGTTCTGCCTCCAGCCCCGCGATGAGAAGCCGTTCTGTGCTACATGTCGTGGGTTGCGGAGGAGGTGCCAGCGAGATGCCATGTGCTGCCCTGGGACACTCTGTGTGAACGATGTTTGTACTACGATGGAAGATGCAACCCCAATATTAGAAAGGCAGCTTGATGAGCAAGATGGCACACATGCAGAAGGAACAACTGGGCACCCAGTCCAGGAAAACCAACCCAAAAGGAAGCCAAGTATTAAGAAATCACAAGGCAGGAAGGGACAAGAGGGAGAAAGTTGTCTGAGAACTTTTGACTGTGGCCCTGGACTTTGCTGTGCTCGTCATTTTTGGACGAAAATTTGTAAGCCAGTCCTTTTGGAGGGACAGGTCTGCTCCAGAAGAGGGCATAAAGACACTGCTCAAGCTCCAGAAATCTTCCAGCGTTGCGACTGTGGCCCTGGACTACTGTGTCGAAGCCAATTGACCAGCAATCGGCAGCATGCTCGATTAAGAGTATGCCAAAAAATAGAAAAGCTATAA
ORF Protein Sequence MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHARLRVCQKIEKL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0888-Ab Anti-DKK4/ DKK-4 functional antibody
    Target Antigen GM-Tg-g-SE0888-Ag DKK4 protein
    ORF Viral Vector pGMLP002081 Human DKK4 Lentivirus plasmid
    ORF Viral Vector vGMLP002081 Human DKK4 Lentivirus particle


    Target information

    Target ID GM-SE0888
    Target Name DKK4
    Gene ID 27121, 234130, 705011, 502097, 101099547, 607210, 509338, 100054568
    Gene Symbol and Synonyms DKK-4,DKK4,RGD1563172
    Uniprot Accession Q9UBT3
    Uniprot Entry Name DKK4_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Renal cell carcinoma
    Gene Ensembl ENSG00000104371
    Target Classification Not Available

    This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. Activity of this protein is modulated by binding to the Wnt co-receptor and the co-factor kremen 2. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.