Human FXYD1/PLM ORF/cDNA clone-Lentivirus plasmid (NM_005031)

Cat. No.: pGMLP002101
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FXYD1/PLM Lentiviral expression plasmid for FXYD1 lentivirus packaging, FXYD1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to FXYD1/PLM products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002101
Gene Name FXYD1
Accession Number NM_005031
Gene ID 5348
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 279 bp
Gene Alias PLM
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGTCTCTTGGCCACATCTTGGTTTTCTGTGTGGGTCTCCTCACCATGGCCAAGGCAGAAAGTCCAAAGGAACACGACCCGTTCACTTACGACTACCAGTCCCTGCAGATCGGAGGCCTCGTCATCGCCGGGATCCTCTTCATCCTGGGCATCCTCATCGTGCTGAGCAGAAGATGCCGGTGCAAGTTCAACCAGCAGCAGAGGACTGGGGAACCCGATGAAGAGGAGGGAACTTTCCGCAGCTCCATCCGCCGTCTGTCCACCCGCAGGCGGTAG
ORF Protein Sequence MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0454-Ab Anti-PLM/ FXYD1 monoclonal antibody
    Target Antigen GM-Tg-g-MP0454-Ag FXYD1 VLP (virus-like particle)
    ORF Viral Vector pGMLP002101 Human FXYD1 Lentivirus plasmid
    ORF Viral Vector vGMLP002101 Human FXYD1 Lentivirus particle


    Target information

    Target ID GM-MP0454
    Target Name FXYD1
    Gene ID 5348, 56188, 721628, 58971, 105261259, 476487, 616139, 100630886
    Gene Symbol and Synonyms 0610012C17Rik,1110006M24Rik,FXYD1,PLM,Pml
    Uniprot Accession O00168
    Uniprot Entry Name PLM_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000266964
    Target Classification Not Available

    This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. The protein encoded by this gene is a plasma membrane substrate for several kinases, including protein kinase A, protein kinase C, NIMA kinase, and myotonic dystrophy kinase. It is thought to form an ion channel or regulate ion channel activity. Transcript variants with different 5' UTR sequences have been described in the literature. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.