Human GPR18 ORF/cDNA clone-Lentivirus plasmid (NM_005292)

Cat. No.: pGMLP002108
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GPR18/ Lentiviral expression plasmid for GPR18 lentivirus packaging, GPR18 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to GPR18/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $549
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002108
Gene Name GPR18
Accession Number NM_005292
Gene ID 2841
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 996 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATCACCCTGAACAATCAAGATCAACCTGTCCCTTTTAACAGCTCACATCCAGATGAATACAAAATTGCAGCCCTTGTCTTCTATAGCTGTATCTTCATAATTGGATTATTTGTTAACATCACTGCATTATGGGTTTTCAGTTGTACCACCAAGAAGAGAACCACGGTAACCATCTATATGATGAATGTGGCATTAGTGGACTTGATATTTATAATGACTTTACCCTTTCGAATGTTTTATTATGCAAAAGATGAATGGCCATTTGGAGAGTACTTCTGCCAGATTCTTGGAGCTCTCACAGTGTTTTACCCAAGCATTGCTTTATGGCTTCTTGCCTTTATTAGTGCTGACAGATACATGGCCATTGTACAGCCGAAGTACGCCAAAGAACTTAAAAACACGTGCAAAGCCGTGCTGGCGTGTGTGGGAGTCTGGATAATGACCCTGACCACGACCACCCCTCTGCTACTGCTCTATAAAGACCCAGATAAAGACTCCACTCCCGCCACCTGCCTCAAGATTTCTGACATCATCTATCTAAAAGCTGTGAACGTGCTGAACCTCACTCGACTGACATTTTTTTTCTTGATTCCTTTGTTCATCATGATTGGGTGCTACTTGGTCATTATTCATAATCTCCTTCACGGCAGGACGTCTAAGCTGAAACCCAAAGTCAAGGAGAAGTCCATAAGGATCATCATCACGCTGCTGGTGCAGGTGCTCGTCTGCTTTATGCCCTTCCACATCTGTTTCGCTTTCCTGATGCTGGGAACGGGGGAGAACAGTTACAATCCCTGGGGAGCCTTTACCACCTTCCTCATGAACCTCAGCACGTGTCTGGATGTGATTCTCTACTACATCGTTTCAAAACAATTTCAGGCTCGAGTCATTAGTGTCATGCTATACCGTAATTACCTTCGAAGCATGCGCAGAAAAAGTTTCCGATCTGGTAGTCTACGGTCACTAAGCAATATAAACAGTGAAATGTTATGA
ORF Protein Sequence MITLNNQDQPVPFNSSHPDEYKIAALVFYSCIFIIGLFVNITALWVFSCTTKKRTTVTIYMMNVALVDLIFIMTLPFRMFYYAKDEWPFGEYFCQILGALTVFYPSIALWLLAFISADRYMAIVQPKYAKELKNTCKAVLACVGVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIYLKAVNVLNLTRLTFFFLIPLFIMIGCYLVIIHNLLHGRTSKLKPKVKEKSIRIIITLLVQVLVCFMPFHICFAFLMLGTGENSYNPWGAFTTFLMNLSTCLDVILYYIVSKQFQARVISVMLYRNYLRSMRRKSFRSGSLRSLSNINSEML

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T72267-Ab Anti-GPR18 monoclonal antibody
    Target Antigen GM-Tg-g-T72267-Ag GPR18 VLP (virus-like particle)
    ORF Viral Vector pGMLP002108 Human GPR18 Lentivirus plasmid
    ORF Viral Vector vGMLP002108 Human GPR18 Lentivirus particle


    Target information

    Target ID GM-T72267
    Target Name GPR18
    Gene ID 2841, 110168, 698714, 679957, 109498980, 485531, 540038, 100147633
    Gene Symbol and Synonyms DRV2,GPR18
    Uniprot Accession Q14330
    Uniprot Entry Name GPR18_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000125245
    Target Classification GPCR

    Predicted to enable G protein-coupled receptor activity. Predicted to be involved in positive regulation of Rho protein signal transduction and positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway. Predicted to act upstream of or within T cell differentiation; negative regulation of leukocyte chemotaxis; and negative regulation of tumor necrosis factor production. Predicted to be located in plasma membrane. Predicted to be integral component of plasma membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.