Human UBTD1 ORF/cDNA clone-Lentivirus plasmid (NM_024954)
Cat. No.: pGMLP002213
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human UBTD1/ Lentiviral expression plasmid for UBTD1 lentivirus packaging, UBTD1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
UBTD1/ products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP002213 |
Gene Name | UBTD1 |
Accession Number | NM_024954 |
Gene ID | 80019 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 684 bp |
Gene Alias | |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGGCAACTGCGTGGGGAGACAGCGCCGGGAGAGGCCGGCAGCCCCGGGACACCCCCGCAAGCGAGCAGGACGCAATGAGCCCCTGAAGAAAGAGCGGCTTAAGTGGAAGAGCGACTACCCCATGACTGACGGGCAGCTGCGGAGCAAACGGGATGAGTTCTGGGACACAGCGCCTGCCTTCGAGGGCCGCAAGGAGATCTGGGATGCCCTCAAGGCTGCCGCCTATGCTGCTGAAGCCAACGACCACGAGCTGGCCCAGGCCATCCTGGATGGAGCCAGCATCACCCTGCCTCATGGCACCCTCTGTGAATGCTACGATGAGCTGGGCAATCGCTACCAGCTGCCCATCTACTGCCTGTCACCGCCGGTGAACCTGCTGCTGGAGCACACGGAGGAGGAGAGCCTGGAGCCCCCCGAGCCTCCACCCAGCGTGCGCCGTGAGTTCCCGCTGAAGGTGCGCCTGTCCACGGGCAAGGACGTGAGGCTCAGCGCCAGCCTGCCCGACACAGTGGGGCAGCTCAAGAGGCAGCTGCACGCCCAGGAGGGCATCGAGCCATCGTGGCAGCGGTGGTTCTTCTCCGGGAAGCTGCTCACAGACCGCACACGGCTCCAGGAGACCAAGATCCAGAAAGATTTTGTCATCCAGGTCATCATCAACCAGCCCCCACCACCCCAGGACTGA |
ORF Protein Sequence | MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP2801-Ab | Anti-UBTD1 monoclonal antibody |
Target Antigen | GM-Tg-g-IP2801-Ag | UBTD1 protein |
ORF Viral Vector | pGMLP002213 | Human UBTD1 Lentivirus plasmid |
ORF Viral Vector | vGMLP002213 | Human UBTD1 Lentivirus particle |
Target information
Target ID | GM-IP2801 |
Target Name | UBTD1 |
Gene ID | 80019, 226122, 706430, 309373, 101100921, 486821, 506002, 100070708 |
Gene Symbol and Synonyms | UBTD1 |
Uniprot Accession | Q9HAC8 |
Uniprot Entry Name | UBTD1_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000165886 |
Target Classification | Not Available |
The degradation of many proteins is carried out by the ubiquitin pathway in which proteins are targeted for degradation by covalent conjugation of the polypeptide ubiquitin. This gene encodes a protein that belongs to the ubiquitin family of proteins. The encoded protein is thought to regulate E2 ubiquitin conjugating enzymes belonging to the UBE2D family. [provided by RefSeq, Mar 2014]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.