Human UBTD1 ORF/cDNA clone-Lentivirus particle (NM_024954)

Cat. No.: vGMLP002213

Pre-made Human UBTD1/ Lentiviral expression plasmid for UBTD1 lentivirus packaging, UBTD1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to UBTD1/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002213 Human UBTD1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002213
Gene Name UBTD1
Accession Number NM_024954
Gene ID 80019
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 684 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCAACTGCGTGGGGAGACAGCGCCGGGAGAGGCCGGCAGCCCCGGGACACCCCCGCAAGCGAGCAGGACGCAATGAGCCCCTGAAGAAAGAGCGGCTTAAGTGGAAGAGCGACTACCCCATGACTGACGGGCAGCTGCGGAGCAAACGGGATGAGTTCTGGGACACAGCGCCTGCCTTCGAGGGCCGCAAGGAGATCTGGGATGCCCTCAAGGCTGCCGCCTATGCTGCTGAAGCCAACGACCACGAGCTGGCCCAGGCCATCCTGGATGGAGCCAGCATCACCCTGCCTCATGGCACCCTCTGTGAATGCTACGATGAGCTGGGCAATCGCTACCAGCTGCCCATCTACTGCCTGTCACCGCCGGTGAACCTGCTGCTGGAGCACACGGAGGAGGAGAGCCTGGAGCCCCCCGAGCCTCCACCCAGCGTGCGCCGTGAGTTCCCGCTGAAGGTGCGCCTGTCCACGGGCAAGGACGTGAGGCTCAGCGCCAGCCTGCCCGACACAGTGGGGCAGCTCAAGAGGCAGCTGCACGCCCAGGAGGGCATCGAGCCATCGTGGCAGCGGTGGTTCTTCTCCGGGAAGCTGCTCACAGACCGCACACGGCTCCAGGAGACCAAGATCCAGAAAGATTTTGTCATCCAGGTCATCATCAACCAGCCCCCACCACCCCAGGACTGA
ORF Protein Sequence MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2801-Ab Anti-UBTD1 monoclonal antibody
    Target Antigen GM-Tg-g-IP2801-Ag UBTD1 protein
    ORF Viral Vector pGMLP002213 Human UBTD1 Lentivirus plasmid
    ORF Viral Vector vGMLP002213 Human UBTD1 Lentivirus particle


    Target information

    Target ID GM-IP2801
    Target Name UBTD1
    Gene ID 80019, 226122, 706430, 309373, 101100921, 486821, 506002, 100070708
    Gene Symbol and Synonyms UBTD1
    Uniprot Accession Q9HAC8
    Uniprot Entry Name UBTD1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000165886
    Target Classification Not Available

    The degradation of many proteins is carried out by the ubiquitin pathway in which proteins are targeted for degradation by covalent conjugation of the polypeptide ubiquitin. This gene encodes a protein that belongs to the ubiquitin family of proteins. The encoded protein is thought to regulate E2 ubiquitin conjugating enzymes belonging to the UBE2D family. [provided by RefSeq, Mar 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.