Human ORMDL3 ORF/cDNA clone-Lentivirus plasmid (NM_139280)

Cat. No.: pGMLP002321
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ORMDL3/ Lentiviral expression plasmid for ORMDL3 lentivirus packaging, ORMDL3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to ORMDL3/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002321
Gene Name ORMDL3
Accession Number NM_139280
Gene ID 94103
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 462 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAATGTGGGCACAGCGCACAGCGAGGTGAACCCCAACACGCGGGTGATGAACAGCCGTGGCATCTGGCTCTCCTACGTGCTGGCCATCGGTCTCCTCCACATCGTGCTGCTGAGCATCCCGTTTGTGAGTGTCCCTGTCGTCTGGACCCTCACCAACCTCATTCACAACATGGGCATGTATATCTTCCTGCACACGGTGAAGGGGACACCCTTTGAGACCCCGGACCAGGGCAAGGCGAGGCTGCTAACCCACTGGGAGCAGATGGATTATGGGGTCCAGTTCACGGCCTCTCGGAAGTTCTTGACCATCACACCCATCGTGCTGTACTTCCTCACCAGCTTCTACACTAAGTACGACCAGATCCATTTTGTGCTCAACACCGTGTCCCTGATGAGCGTGCTTATCCCCAAGCTGCCCCAGCTCCACGGAGTCCGGATTTTTGGAATCAATAAGTACTGA
ORF Protein Sequence MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1303-Ab Anti-ORML3/ ORMDL3 monoclonal antibody
    Target Antigen GM-Tg-g-MP1303-Ag ORMDL3 VLP (virus-like particle)
    ORF Viral Vector pGMLP002321 Human ORMDL3 Lentivirus plasmid
    ORF Viral Vector pGMAD001145 Human ORMDL3 Adenovirus plasmid
    ORF Viral Vector vGMLP002321 Human ORMDL3 Lentivirus particle
    ORF Viral Vector vGMAD001145 Human ORMDL3 Adenovirus particle


    Target information

    Target ID GM-MP1303
    Target Name ORMDL3
    Gene ID 94103, 66612, 699154, 360618, 101093408, 480530, 615368, 100054640
    Gene Symbol and Synonyms 2810011N17Rik,LRRGT00183,ORMDL3
    Uniprot Accession Q8N138
    Uniprot Entry Name ORML3_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Dent disease
    Gene Ensembl ENSG00000172057
    Target Classification Not Available

    Involved in ceramide metabolic process. Acts upstream of or within several processes, including negative regulation of B cell apoptotic process; negative regulation of ceramide biosynthetic process; and positive regulation of protein localization to nucleus. Located in endoplasmic reticulum. Part of SPOTS complex. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.