Human MAL2 ORF/cDNA clone-Lentivirus plasmid (NM_052886)

Cat. No.: pGMLP002369
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MAL2/ Lentiviral expression plasmid for MAL2 lentivirus packaging, MAL2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to MAL2/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $432.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002369
Gene Name MAL2
Accession Number NM_052886
Gene ID 114569
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 531 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCGGCCGGCGGAGCGTCAGTCCCGCCGCCCCCGAACCCCGCCGTGTCCTTCCCGCCGCCCCGGGTCACCCTGCCCGCCGGCCCCGACATCCTGCGGACCTACTCGGGCGCCTTCGTCTGCCTGGAGATTCTGTTCGGGGGTCTTGTCTGGATTTTGGTTGCCTCCTCCAATGTTCCTCTACCTCTACTACAAGGATGGGTCATGTTTGTGTCCGTGACAGCGTTTTTCTTTTCGCTCCTCTTTCTGGGCATGTTCCTCTCTGGCATGGTGGCTCAAATTGATGCTAACTGGAACTTCCTGGATTTTGCCTACCATTTTACAGTATTTGTCTTCTATTTTGGAGCCTTTTTATTGGAAGCAGCAGCCACATCCCTGCATGATTTGCATTGCAATACAACCATAACCGGGCAGCCACTCCTGAGTGATAACCAGTATAACATAAACGTAGCAGCCTCAATTTTTGCCTTTATGACGACAGCTTGTTATGGTTGCAGTTTGGGTCTGGCTTTACGAAGATGGCGACCGTAA
ORF Protein Sequence MSAGGASVPPPPNPAVSFPPPRVTLPAGPDILRTYSGAFVCLEILFGGLVWILVASSNVPLPLLQGWVMFVSVTAFFFSLLFLGMFLSGMVAQIDANWNFLDFAYHFTVFVFYFGAFLLEAAATSLHDLHCNTTITGQPLLSDNQYNINVAASIFAFMTTACYGCSLGLALRRWRP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1137-Ab Anti-MAL2 monoclonal antibody
    Target Antigen GM-Tg-g-IP1137-Ag MAL2 protein
    ORF Viral Vector pGMLP002369 Human MAL2 Lentivirus plasmid
    ORF Viral Vector vGMLP002369 Human MAL2 Lentivirus particle


    Target information

    Target ID GM-IP1137
    Target Name MAL2
    Gene ID 114569, 105853, 705045, 362911, 101081865, 608995, 511940, 100066039
    Gene Symbol and Synonyms MAL2
    Uniprot Accession Q969L2
    Uniprot Entry Name MAL2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000147676
    Target Classification Not Available

    This gene encodes a multispan transmembrane protein belonging to the MAL proteolipid family. The protein is a component of lipid rafts and, in polarized cells, it primarily localizes to endosomal structures beneath the apical membrane. It is required for transcytosis, an intracellular transport pathway used to deliver membrane-bound proteins and exogenous cargos from the basolateral to the apical surface. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.