Human HTN3/HIS2/HTN2 ORF/cDNA clone-Lentivirus plasmid (NM_000200)

Cat. No.: pGMLP002420
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human HTN3/HIS2/HTN2 Lentiviral expression plasmid for HTN3 lentivirus packaging, HTN3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to HTN3/HIS2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002420
Gene Name HTN3
Accession Number NM_000200
Gene ID 3347
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 156 bp
Gene Alias HIS2,HTN2,HTN5
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGTTTTTTGTTTTTGCTTTAATCTTGGCTCTCATGCTTTCCATGACTGGAGCTGATTCACATGCAAAGAGACATCATGGGTATAAAAGAAAATTCCATGAAAAGCATCATTCACATCGAGGCTATAGATCAAATTATCTGTATGACAATTGA
ORF Protein Sequence MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0971-Ab Anti-HIS3/ HTN3/ HIS2 functional antibody
    Target Antigen GM-Tg-g-SE0971-Ag HTN3 protein
    ORF Viral Vector pGMLP002420 Human HTN3 Lentivirus plasmid
    ORF Viral Vector vGMLP002420 Human HTN3 Lentivirus particle


    Target information

    Target ID GM-SE0971
    Target Name HTN3
    Gene ID 3347
    Gene Symbol and Synonyms HIS2,HTN2,HTN3,HTN5,PB
    Uniprot Accession P15516
    Uniprot Entry Name HIS3_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000205649
    Target Classification Not Available

    This gene encodes a member of the histatin family of small, histidine-rich, cationic proteins. They function as antimicrobial peptides and are important components of the innate immune system. Histatins are found in saliva and exhibit antibacterial, antifungal activities and function in wound healing. [provided by RefSeq, Sep 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.