Human NDUFC2/B14.5b/CI-B14.5b ORF/cDNA clone-Lentivirus plasmid (NM_004549)

Cat. No.: pGMLP002467
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human NDUFC2/B14.5b/CI-B14.5b Lentiviral expression plasmid for NDUFC2 lentivirus packaging, NDUFC2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to NDUFC2/B14.5b products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002467
Gene Name NDUFC2
Accession Number NM_004549
Gene ID 4718
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 360 bp
Gene Alias B14.5b,CI-B14.5b,HLC-1,NADHDH2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATCGCACGGCGGAACCCAGAACCCTTACGGTTTCTGCCGGATGAGGCCCGGAGCCTGCCCCCGCCCAAGCTGACCGACCCGCGGCTCCTCTACATCGGCTTCTTGGGCTACTGCTCCGGCCTGATTGATAACCTAATCCGGCGGAGGCCGATCGCGACGGCTGGTTTGCATCGCCAGCTTCTATATATTACGGCCTTTTTTTTTGCTGGATATTATCTTGTAAAACGTGAAGACTACCTGTATGCTGTGAGGGACCGTGAAATGTTTGGATATATGAAATTACATCCAGAGGATTTTCCTGAAGAAGATAAGAAAACATATGGTGAAATTTTTGAAAAATTCCATCCAATACGTTGA
ORF Protein Sequence MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0871-Ab Anti-NDUC2/ NDUFC2/ B14.5b monoclonal antibody
    Target Antigen GM-Tg-g-MP0871-Ag NDUFC2 VLP (virus-like particle)
    ORF Viral Vector pGMLP002467 Human NDUFC2 Lentivirus plasmid
    ORF Viral Vector vGMLP002467 Human NDUFC2 Lentivirus particle


    Target information

    Target ID GM-MP0871
    Target Name NDUFC2
    Gene ID 4718, 68197, 100426173, 293130, 101080736, 476794, 338046
    Gene Symbol and Synonyms 1810004I06Rik,2010300P09Rik,B14.5b,CI-B14.5b,G1,HLC-1,MC1DN36,NADHDH2,NDUFC2
    Uniprot Accession O95298
    Uniprot Entry Name NDUC2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000151366
    Target Classification Not Available

    Involved in mitochondrial respiratory chain complex I assembly. Located in mitochondrion. Part of mitochondrial respiratory chain complex I. Implicated in nuclear type mitochondrial complex I deficiency. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.