Human NUDT3/DIPP/DIPP-1 ORF/cDNA clone-Lentivirus plasmid (NM_006703)

Cat. No.: pGMLP002504
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human NUDT3/DIPP/DIPP-1 Lentiviral expression plasmid for NUDT3 lentivirus packaging, NUDT3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to NUDT3/DIPP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $429.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002504
Gene Name NUDT3
Accession Number NM_006703
Gene ID 11165
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 519 bp
Gene Alias DIPP,DIPP-1,DIPP1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATGAAGCTCAAGTCGAACCAGACCCGCACCTACGACGGCGACGGCTACAAGAAGCGGGCCGCATGCCTGTGTTTCCGCAGCGAGAGCGAGGAGGAGGTGCTACTCGTGAGCAGTAGTCGCCATCCAGACAGATGGATTGTCCCTGGAGGAGGCATGGAGCCCGAGGAGGAGCCAAGTGTGGCAGCAGTTCGTGAAGTCTGTGAGGAGGCTGGAGTAAAAGGGACATTGGGAAGATTAGTTGGAATTTTTGAGAACCAGGAGAGGAAGCACAGGACGTATGTCTATGTGCTCATTGTCACTGAAGTGCTGGAAGACTGGGAAGATTCAGTTAACATTGGAAGGAAGAGGGAATGGTTTAAAATAGAAGACGCCATAAAAGTGCTGCAGTATCACAAACCCGTGCAGGCATCATATTTTGAAACATTGAGGCAAGGCTACTCAGCCAACAATGGCACCCCAGTCGTGGCCACCACATACTCGGTTTCTGCTCAGAGCTCGATGTCAGGCATCAGATGA
ORF Protein Sequence MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T26748-Ab Anti-NUDT3 monoclonal antibody
    Target Antigen GM-Tg-g-T26748-Ag NUDT3 protein
    ORF Viral Vector pGMLP002504 Human NUDT3 Lentivirus plasmid
    ORF Viral Vector vGMLP002504 Human NUDT3 Lentivirus particle


    Target information

    Target ID GM-T26748
    Target Name NUDT3
    Gene ID 11165, 56409, 718568, 294292, 100846983, 618855, 102149351
    Gene Symbol and Synonyms 1110011B09Rik,DIPP,DIPP-1,DIPP1,NUDT3
    Uniprot Accession O95989
    Uniprot Entry Name NUDT3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000272325
    Target Classification Not Available

    NUDT3 belongs to the MutT, or Nudix, protein family. Nudix proteins act as homeostatic checkpoints at important stages in nucleoside phosphate metabolic pathways, guarding against elevated levels of potentially dangerous intermediates, like 8-oxo-dGTP, which promotes AT-to-CG transversions (Safrany et al., 1998 [PubMed 9822604]).[supplied by OMIM, Feb 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.