Human NUDT3/DIPP/DIPP-1 ORF/cDNA clone-Lentivirus particle (NM_006703)
Cat. No.: vGMLP002504
Pre-made Human NUDT3/DIPP/DIPP-1 Lentiviral expression plasmid for NUDT3 lentivirus packaging, NUDT3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
NUDT3/DIPP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP002504 | Human NUDT3 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP002504 |
| Gene Name | NUDT3 |
| Accession Number | NM_006703 |
| Gene ID | 11165 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 519 bp |
| Gene Alias | DIPP,DIPP-1,DIPP1 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGATGAAGCTCAAGTCGAACCAGACCCGCACCTACGACGGCGACGGCTACAAGAAGCGGGCCGCATGCCTGTGTTTCCGCAGCGAGAGCGAGGAGGAGGTGCTACTCGTGAGCAGTAGTCGCCATCCAGACAGATGGATTGTCCCTGGAGGAGGCATGGAGCCCGAGGAGGAGCCAAGTGTGGCAGCAGTTCGTGAAGTCTGTGAGGAGGCTGGAGTAAAAGGGACATTGGGAAGATTAGTTGGAATTTTTGAGAACCAGGAGAGGAAGCACAGGACGTATGTCTATGTGCTCATTGTCACTGAAGTGCTGGAAGACTGGGAAGATTCAGTTAACATTGGAAGGAAGAGGGAATGGTTTAAAATAGAAGACGCCATAAAAGTGCTGCAGTATCACAAACCCGTGCAGGCATCATATTTTGAAACATTGAGGCAAGGCTACTCAGCCAACAATGGCACCCCAGTCGTGGCCACCACATACTCGGTTTCTGCTCAGAGCTCGATGTCAGGCATCAGATGA |
| ORF Protein Sequence | MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T26748-Ab | Anti-NUDT3 monoclonal antibody |
| Target Antigen | GM-Tg-g-T26748-Ag | NUDT3 protein |
| ORF Viral Vector | pGMLP002504 | Human NUDT3 Lentivirus plasmid |
| ORF Viral Vector | vGMLP002504 | Human NUDT3 Lentivirus particle |
Target information
| Target ID | GM-T26748 |
| Target Name | NUDT3 |
| Gene ID | 11165, 56409, 718568, 294292, 100846983, 618855, 102149351 |
| Gene Symbol and Synonyms | 1110011B09Rik,DIPP,DIPP-1,DIPP1,NUDT3 |
| Uniprot Accession | O95989 |
| Uniprot Entry Name | NUDT3_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | Not Available |
| Gene Ensembl | ENSG00000272325 |
| Target Classification | Not Available |
NUDT3 belongs to the MutT, or Nudix, protein family. Nudix proteins act as homeostatic checkpoints at important stages in nucleoside phosphate metabolic pathways, guarding against elevated levels of potentially dangerous intermediates, like 8-oxo-dGTP, which promotes AT-to-CG transversions (Safrany et al., 1998 [PubMed 9822604]).[supplied by OMIM, Feb 2011]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


