Human SLC50A1/HsSWEET1/RAG1AP1 ORF/cDNA clone-Lentivirus plasmid (NM_018845)

Cat. No.: pGMLP002516
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SLC50A1/HsSWEET1/RAG1AP1 Lentiviral expression plasmid for SLC50A1 lentivirus packaging, SLC50A1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to SLC50A1/HsSWEET1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $466.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002516
Gene Name SLC50A1
Accession Number NM_018845
Gene ID 55974
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 666 bp
Gene Alias HsSWEET1,RAG1AP1,SCP,slv,SWEET1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGGCGGGCGGCTTTCTGGACTCGCTCATTTACGGAGCATGCGTGGTCTTCACCCTTGGCATGTTCTCCGCCGGCCTCTCGGACCTCAGGCACATGCGAATGACCCGGAGTGTGGACAACGTCCAGTTCCTGCCCTTTCTCACCACGGAAGTCAACAACCTGGGCTGGCTGAGTTATGGGGCTTTGAAGGGAGACGGGATCCTCATCGTCGTCAACACAGTGGGTGCTGCGCTTCAGACCCTGTATATCTTGGCATATCTGCATTACTGCCCTCGGAAGCGTGTTGTGCTCCTACAGACTGCAACCCTGCTAGGGGTCCTTCTCCTGGGTTATGGCTACTTTTGGCTCCTGGTACCCAACCCTGAGGCCCGGCTTCAGCAGTTGGGCCTCTTCTGCAGTGTCTTCACCATCAGCATGTACCTCTCACCACTGGCTGACTTGGCTAAGGTGATTCAAACTAAATCAACCCAATGTCTCTCCTACCCACTCACCATTGCTACCCTTCTCACCTCTGCCTCCTGGTGCCTCTATGGGTTTCGACTCAGAGATCCCTATATCATGGTGTCCAACTTTCCAGGAATCGTCACCAGCTTTATCCGCTTCTGGCTTTTCTGGAAGTACCCCCAGGAGCAAGACAGGAACTACTGGCTCCTGCAAACCTGA
ORF Protein Sequence MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDGILIVVNTVGAALQTLYILAYLHYCPRKRVVLLQTATLLGVLLLGYGYFWLLVPNPEARLQQLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFPGIVTSFIRFWLFWKYPQEQDRNYWLLQT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1643-Ab Anti-SWET1/ SLC50A1/ HsSWEET1 monoclonal antibody
    Target Antigen GM-Tg-g-MP1643-Ag SLC50A1 VLP (virus-like particle)
    ORF Viral Vector pGMLP002516 Human SLC50A1 Lentivirus plasmid
    ORF Viral Vector vGMLP002516 Human SLC50A1 Lentivirus particle


    Target information

    Target ID GM-MP1643
    Target Name SLC50A1
    Gene ID 55974, 19729, 717424, 295245, 101094324, 480132, 520463, 100057221
    Gene Symbol and Synonyms HsSWEET1,MmSWEET1,RAG1AP1,Rga,RGD1308478,SCP,SLC50A1,slv,SWEET1
    Uniprot Accession Q9BRV3
    Uniprot Entry Name SWET1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000169241
    Target Classification Not Available

    Enables glucoside transmembrane transporter activity. Predicted to be involved in carbohydrate transport. Located in Golgi apparatus and plasma membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.