Human HIGD1B/CLST11240/CLST11240-15 ORF/cDNA clone-Lentivirus plasmid (NM_016438)
Cat. No.: pGMLP002534
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human HIGD1B/CLST11240/CLST11240-15 Lentiviral expression plasmid for HIGD1B lentivirus packaging, HIGD1B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
HIGD1B/CLST11240 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP002534 |
Gene Name | HIGD1B |
Accession Number | NM_016438 |
Gene ID | 51751 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 300 bp |
Gene Alias | CLST11240,CLST11240-15 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGTCTGCTAACAGACGCTGGTGGGTACCACCTGACGACGAAGACTGTGTGTCTGAGAAGCTCCTGAGGAAGACTCGGGAATCTCCACTGGTGCCTATAGGCTTAGGAGGCTGCTTGGTGGTAGCAGCATACAGGATTTACCGGCTGAGGTCTCGTGGTTCCACCAAGATGTCCATACACCTGATTCACACCCGAGTGGCAGCGCAGGCCTGTGCAGTGGGTGCAATCATGCTAGGTGCTGTGTACACAATGTACAGCGATTACGTCAAGAGGATGGCACAGGATGCTGGAGAGAAGTAG |
ORF Protein Sequence | MSANRRWWVPPDDEDCVSEKLLRKTRESPLVPIGLGGCLVVAAYRIYRLRSRGSTKMSIHLIHTRVAAQACAVGAIMLGAVYTMYSDYVKRMAQDAGEK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP0965-Ab | Anti-HIGD1B monoclonal antibody |
Target Antigen | GM-Tg-g-IP0965-Ag | HIGD1B protein |
ORF Viral Vector | pGMLP002534 | Human HIGD1B Lentivirus plasmid |
ORF Viral Vector | vGMLP002534 | Human HIGD1B Lentivirus particle |
Target information
Target ID | GM-IP0965 |
Target Name | HIGD1B |
Gene ID | 51751, 75689, 715566, 287738, 101080752, 480496, 510275, 100050651 |
Gene Symbol and Synonyms | 2310056K19Rik,CLST11240,CLST11240-15,HIGD1B,RGD1306907 |
Uniprot Accession | Q9P298 |
Uniprot Entry Name | HIG1B_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000131097 |
Target Classification | Not Available |
This gene encodes a member of the hypoxia inducible gene 1 (HIG1) domain family. The encoded protein is localized to the cell membrane and has been linked to tumorigenesis and the progression of pituitary adenomas. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2012]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.