Human HIGD1B/CLST11240/CLST11240-15 ORF/cDNA clone-Lentivirus particle (NM_016438)

Cat. No.: vGMLP002534

Pre-made Human HIGD1B/CLST11240/CLST11240-15 Lentiviral expression plasmid for HIGD1B lentivirus packaging, HIGD1B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to HIGD1B/CLST11240 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002534 Human HIGD1B Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002534
Gene Name HIGD1B
Accession Number NM_016438
Gene ID 51751
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 300 bp
Gene Alias CLST11240,CLST11240-15
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTGCTAACAGACGCTGGTGGGTACCACCTGACGACGAAGACTGTGTGTCTGAGAAGCTCCTGAGGAAGACTCGGGAATCTCCACTGGTGCCTATAGGCTTAGGAGGCTGCTTGGTGGTAGCAGCATACAGGATTTACCGGCTGAGGTCTCGTGGTTCCACCAAGATGTCCATACACCTGATTCACACCCGAGTGGCAGCGCAGGCCTGTGCAGTGGGTGCAATCATGCTAGGTGCTGTGTACACAATGTACAGCGATTACGTCAAGAGGATGGCACAGGATGCTGGAGAGAAGTAG
ORF Protein Sequence MSANRRWWVPPDDEDCVSEKLLRKTRESPLVPIGLGGCLVVAAYRIYRLRSRGSTKMSIHLIHTRVAAQACAVGAIMLGAVYTMYSDYVKRMAQDAGEK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0965-Ab Anti-HIGD1B monoclonal antibody
    Target Antigen GM-Tg-g-IP0965-Ag HIGD1B protein
    ORF Viral Vector pGMLP002534 Human HIGD1B Lentivirus plasmid
    ORF Viral Vector vGMLP002534 Human HIGD1B Lentivirus particle


    Target information

    Target ID GM-IP0965
    Target Name HIGD1B
    Gene ID 51751, 75689, 715566, 287738, 101080752, 480496, 510275, 100050651
    Gene Symbol and Synonyms 2310056K19Rik,CLST11240,CLST11240-15,HIGD1B,RGD1306907
    Uniprot Accession Q9P298
    Uniprot Entry Name HIG1B_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000131097
    Target Classification Not Available

    This gene encodes a member of the hypoxia inducible gene 1 (HIG1) domain family. The encoded protein is localized to the cell membrane and has been linked to tumorigenesis and the progression of pituitary adenomas. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.