Human CLIC1/CL1C1/G6 ORF/cDNA clone-Lentivirus plasmid (NM_001288)

Cat. No.: pGMLP002665
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CLIC1/CL1C1/G6 Lentiviral expression plasmid for CLIC1 lentivirus packaging, CLIC1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CLIC1/CL1C1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $481.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002665
Gene Name CLIC1
Accession Number NM_001288
Gene ID 1192
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 726 bp
Gene Alias CL1C1,G6,NCC27
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGAAGAACAACCGCAGGTCGAATTGTTCGTGAAGGCTGGCAGTGATGGGGCCAAGATTGGGAACTGCCCATTCTCCCAGAGACTGTTCATGGTACTGTGGCTCAAGGGAGTCACCTTCAATGTTACCACCGTTGACACCAAAAGGCGGACCGAGACAGTGCAGAAGCTGTGCCCAGGGGGGCAGCTCCCATTCCTGCTGTATGGCACTGAAGTGCACACAGACACCAACAAGATTGAGGAATTTCTGGAGGCAGTGCTGTGCCCTCCCAGGTACCCCAAGCTGGCAGCTCTGAACCCTGAGTCCAACACAGCTGGGCTGGACATATTTGCCAAATTTTCTGCCTACATCAAGAATTCAAACCCAGCACTCAATGACAATCTGGAGAAGGGACTCCTGAAAGCCCTGAAGGTTTTAGACAATTACTTAACATCCCCCCTCCCAGAAGAAGTGGATGAAACCAGTGCTGAAGATGAAGGTGTCTCTCAGAGGAAGTTTTTGGATGGCAACGAGCTCACCCTGGCTGACTGCAACCTGTTGCCAAAGTTACACATAGTACAGGTGGTGTGTAAGAAGTACCGGGGATTCACCATCCCCGAGGCCTTCCGGGGAGTGCATCGGTACTTGAGCAATGCCTACGCCCGGGAAGAATTCGCTTCCACCTGTCCAGATGATGAGGAGATCGAGCTCGCCTATGAGCAAGTGGCAAAGGCCCTCAAATAA
ORF Protein Sequence MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T99092-Ab Anti-CLIC1/ CL1C1/ G6 monoclonal antibody
    Target Antigen GM-Tg-g-T99092-Ag CLIC1 VLP (virus-like particle)
    ORF Viral Vector pGMLP002665 Human CLIC1 Lentivirus plasmid
    ORF Viral Vector pGMLV002296 Human CLIC1 Lentivirus plasmid
    ORF Viral Vector vGMLP002665 Human CLIC1 Lentivirus particle
    ORF Viral Vector vGMLV002296 Human CLIC1 Lentivirus particle


    Target information

    Target ID GM-T99092
    Target Name CLIC1
    Gene ID 1192, 114584, 406864, 101089516, 474847, 515646, 100058853
    Gene Symbol and Synonyms CL1C1,CLCNL1,Clcp,CLIC1,G6,NCC27
    Uniprot Accession O00299
    Uniprot Entry Name CLIC1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000213719
    Target Classification Not Available

    Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1  is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.