Human CLIC1/CL1C1/G6 ORF/cDNA clone-Lentivirus plasmid (NM_001288)
Cat. No.: pGMLP002665
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CLIC1/CL1C1/G6 Lentiviral expression plasmid for CLIC1 lentivirus packaging, CLIC1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
CLIC1/CL1C1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP002665 |
Gene Name | CLIC1 |
Accession Number | NM_001288 |
Gene ID | 1192 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 726 bp |
Gene Alias | CL1C1,G6,NCC27 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCTGAAGAACAACCGCAGGTCGAATTGTTCGTGAAGGCTGGCAGTGATGGGGCCAAGATTGGGAACTGCCCATTCTCCCAGAGACTGTTCATGGTACTGTGGCTCAAGGGAGTCACCTTCAATGTTACCACCGTTGACACCAAAAGGCGGACCGAGACAGTGCAGAAGCTGTGCCCAGGGGGGCAGCTCCCATTCCTGCTGTATGGCACTGAAGTGCACACAGACACCAACAAGATTGAGGAATTTCTGGAGGCAGTGCTGTGCCCTCCCAGGTACCCCAAGCTGGCAGCTCTGAACCCTGAGTCCAACACAGCTGGGCTGGACATATTTGCCAAATTTTCTGCCTACATCAAGAATTCAAACCCAGCACTCAATGACAATCTGGAGAAGGGACTCCTGAAAGCCCTGAAGGTTTTAGACAATTACTTAACATCCCCCCTCCCAGAAGAAGTGGATGAAACCAGTGCTGAAGATGAAGGTGTCTCTCAGAGGAAGTTTTTGGATGGCAACGAGCTCACCCTGGCTGACTGCAACCTGTTGCCAAAGTTACACATAGTACAGGTGGTGTGTAAGAAGTACCGGGGATTCACCATCCCCGAGGCCTTCCGGGGAGTGCATCGGTACTTGAGCAATGCCTACGCCCGGGAAGAATTCGCTTCCACCTGTCCAGATGATGAGGAGATCGAGCTCGCCTATGAGCAAGTGGCAAAGGCCCTCAAATAA |
ORF Protein Sequence | MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T99092-Ab | Anti-CLIC1/ CL1C1/ G6 monoclonal antibody |
Target Antigen | GM-Tg-g-T99092-Ag | CLIC1 VLP (virus-like particle) |
ORF Viral Vector | pGMLP002665 | Human CLIC1 Lentivirus plasmid |
ORF Viral Vector | pGMLV002296 | Human CLIC1 Lentivirus plasmid |
ORF Viral Vector | vGMLP002665 | Human CLIC1 Lentivirus particle |
ORF Viral Vector | vGMLV002296 | Human CLIC1 Lentivirus particle |
Target information
Target ID | GM-T99092 |
Target Name | CLIC1 |
Gene ID | 1192, 114584, 406864, 101089516, 474847, 515646, 100058853 |
Gene Symbol and Synonyms | CL1C1,CLCNL1,Clcp,CLIC1,G6,NCC27 |
Uniprot Accession | O00299 |
Uniprot Entry Name | CLIC1_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | Not Available |
Gene Ensembl | ENSG00000213719 |
Target Classification | Not Available |
Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.